KEGG   Clostridium perfringens SM101: CPR_1719Help
Entry
CPR_1719          CDS       T00379                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00230  Purine metabolism
cpr01100  Metabolic pathways
Module
cpr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CPR_1719 (gmk)
Enzymes [BR:cpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CPR_1719 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 MMR_HSR1 AAA_22 Thymidylate_kin ABC_tran Cytidylate_kin CPT ADK AAA_17 RsgA_GTPase Zeta_toxin AAA AAA_29 AAA_16 Rad17 AAA_28 T2SSE ATP-synt_ab AAA_30
Motif
Other DBs
NCBI-ProteinID: ABG87421
UniProt: Q0SS73
Position
complement(1914597..1915247)
Genome map
AA seq 216 aa AA seqDB search
MMNKIHKNNRGVLIVISGPSGAGKGTICKALLEKHDDIFISVSATTRNPRVGEVDGVNYH
FLTKEEFKQRIAEDDFLEHAEVYGNYYGTPKSSVEKMLDEGKNVILEIDIQGALKVKEKA
TDGVFIFILPPSMEELKQRIIKRGSETPESLMTRFKSAYKEINYVSKYNYAVVNDNVEDA
VKKIEAILLAEKCRVDRLKENLLESKEDEMHEQLYD
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataagatacataagaataatagaggtgtattaatagttatttctggtccttca
ggtgcaggtaagggaactatttgtaaagccttattagaaaaacacgatgatatattcata
tcagtttctgctacaactagaaaccctagagtaggagaagttgatggagttaattatcat
ttcttaacaaaagaagaatttaaacaaagaatagcagaggatgatttccttgagcatgct
gaagtatatggaaattattatggaactcctaaatcaagtgttgaaaaaatgcttgatgaa
ggaaaaaacgtaatattagaaatagatatacaaggtgctttaaaagttaaggaaaaggct
actgatggagtatttatctttatattacctccttcaatggaagagcttaagcaaagaata
ataaaaagaggtagcgaaactccagaaagtttaatgactagatttaagtcagcttataaa
gaaattaattatgtgtcaaaatacaattatgcagtagttaacgataatgtagaagatgca
gtaaagaaaatagaagctatattattagcagaaaaatgtagagtagatagattaaaagaa
aacttattagagtcaaaggaggacgaaatgcatgaacaactctatgattaa

DBGET integrated database retrieval system