KEGG   Clostridium perfringens SM101: CPR_2382Help
Entry
CPR_2382          CDS       T00379                                 

Gene name
rpsE
Definition
(GenBank) 30S ribosomal protein S5
  KO
K02988  small subunit ribosomal protein S5
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CPR_2382 (rpsE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpr03011]
    CPR_2382 (rpsE)
Ribosome [BR:cpr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CPR_2382 (rpsE)
  Bacteria
    CPR_2382 (rpsE)
  Archaea
    CPR_2382 (rpsE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S5 Ribosomal_S5_C NTPase_I-T
Motif
Other DBs
NCBI-ProteinID: ABG85869
UniProt: Q0SQG1
Position
complement(2608984..2609481)
Genome map
AA seq 165 aa AA seqDB search
MRIDPSTLDLKEKVVSISRVTKVVKGGRNFRFSALVVVGDENGHVGVGTGKSIEIPEAIR
KGIEDAKKNLVEVSIVGTTVPHEIHGKFGTGDVLIMPATEGTGVIAGGPARSVLELAGLK
DVRAKSLGSNNPRNMVKATINGLANLRTAEDIAKLRGKSVEEIIG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgatcctagcacactagaccttaaagaaaaggttgttagtataagcagagtt
actaaggttgttaagggtggtagaaacttcagattcagtgcgttagttgttgttggagac
gagaacggacacgttggtgttggaactggtaaatctatcgaaatccctgaagcaataaga
aaaggaatagaagatgctaagaaaaacttagtagaagtttcaatagttggaactactgtt
cctcatgaaatacacggaaaattcggtacaggagatgtacttataatgccagctactgaa
ggtacaggagttatagctggaggtcctgcaagatcagttcttgaattagcaggattaaag
gatgttagagctaaatcattaggttcaaacaacccaagaaacatggtaaaagcaactatc
aacggattagctaacttaagaacagctgaagatatagctaaattaagaggaaaatctgtt
gaagagataataggttag

DBGET integrated database retrieval system