KEGG   Clostridium perfringens SM101: CPR_2399
Entry
CPR_2399          CDS       T00379                                 

Gene name
rplC
Definition
(GenBank) 50S ribosomal protein L3
  KO
K02906  large subunit ribosomal protein L3
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CPR_2399 (rplC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpr03011]
    CPR_2399 (rplC)
Ribosome [BR:cpr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CPR_2399 (rplC)
  Bacteria
    CPR_2399 (rplC)
  Archaea
    CPR_2399 (rplC)
SSDB
Motif
Pfam: Ribosomal_L3
Other DBs
NCBI-ProteinID: ABG86708
UniProt: Q0SQE4
Position
complement(2616635..2617264)
AA seq 209 aa
MKKAIIGKKVGMTQIFDENGRVIPVTVVEAGPCVVVQKKTVETDGYDAIQVGFGELREKL
VNKPRRGHFAKAGVSLRRTLKEFRMEDVANYNVGDEIKVDTFEIGDKVDVSGVSKGKGFQ
GTIKRWNASRGPMSHGSKFHRAPGSMGAASDPSRTFKNKRMPGHMGAKNTTVLNLEVVKI
MPEKNIILIKGGIPGPNKGTIVIRNSVKA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgaaaaaagctataataggtaaaaaagttggaatgactcaaatattcgatgagaatggt
agagtaatccctgtaactgtagttgaagctggtccatgtgttgtagttcaaaagaaaaca
gttgaaactgatggatatgacgcaatacaagttggattcggtgaattaagagaaaaatta
gttaacaaaccaagaagaggacattttgctaaagcaggtgtttctttaagaagaacttta
aaagagttcagaatggaagatgttgctaattacaatgttggagacgaaataaaggttgac
acatttgaaattggagacaaagtagacgtatcaggagtttctaaaggtaagggattccaa
ggtacaatcaaaagatggaatgctagtagaggaccaatgtctcacggttctaaattccac
agagcaccaggttcaatgggagctgcttcagacccatcaagaactttcaagaacaaaaga
atgcctggacatatgggagctaagaacacaactgttcttaacttagaagttgttaagata
atgcctgaaaagaacatcatcttaatcaaggggggaatcccaggtccaaataaaggcaca
atagttataagaaacagcgttaaggcttaa

DBGET integrated database retrieval system