KEGG   Clostridium perfringens SM101: CPR_2533Help
Entry
CPR_2533          CDS       T00379                                 

Gene name
metG_2
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00450  Selenocompound metabolism
cpr00970  Aminoacyl-tRNA biosynthesis
cpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CPR_2533 (metG_2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPR_2533 (metG_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cpr01007]
    CPR_2533 (metG_2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cpr03016]
    CPR_2533 (metG_2)
Enzymes [BR:cpr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CPR_2533 (metG_2)
Amino acid related enzymes [BR:cpr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CPR_2533 (metG_2)
Transfer RNA biogenesis [BR:cpr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CPR_2533 (metG_2)
 Prokaryotic type
   Other AARSs
    CPR_2533 (metG_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 DNA_ligase_ZBD DUF1272
Motif
Other DBs
NCBI-ProteinID: ABG87431
UniProt: Q0SQ27
Position
complement(2753786..2755723)
Genome map
AA seq 645 aa AA seqDB search
MCKKPYYITTPIYYPSTNLHIGNTYTTVAADAIARFKRLTGHEVMFLTGTDEHGQKIERI
ANEKGITPKEHVDEIVAGIKDLWKMMNISYDKFIRTTDDYHVKAVQEIFKKLYDQGDIYK
DSYEGLYCTPCESFWTETQLVNGNCPDCGRPVEKAKEEAYFFKMSKYADRLIQYIEEHPD
FIQPESRKNEMLNNFLRPGLQDLCVSRTSFTWGIPVSFDEKHVIYVWIDALSNYITALGY
GQENQELYKKFWPADVHLIGKDILRFHTIYWPIMLMALGLELPKQVFGHGWLLVDGGKMS
KSKGNVVDPVVLVNMFGADAVRYYLLREIPFGSDGLFNNEIFIKKVNTDLANDLGNLLSR
TIAMVYKYFDGVIQAPTCKEAIDDELINLALSTPGKVEASIDALKIPEALESIWTLISRA
NKYIDETTPWILAKDEEKKERLGTVLYNLLETLRFVSVMISPFLTETSVKINDQLNTKVT
TWESLKEFNGTVAGDKVVKGDVIFPRIDVEEKLAELEALKPAPVKPANEELVKNPIKEEI
TIDDFDKIDLRVVKVLECEPVKKAKKLLKLKVDLGGEERQVISGIAQYYKPEELVGKYVV
LVANLKPVKLRGELSQGMILAAAPSDDSELVLVNPGEMLTGSQVR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaaaaaccatattatattacaacgcctatttattacccatcaacaaatctacac
ataggtaatacttatacaactgtggctgctgatgctatagcaagatttaaaagacttaca
ggtcacgaagtaatgttcttaacaggaacagatgagcatggtcaaaaaatagaaagaata
gctaatgaaaaaggaattactccaaaggagcatgttgacgaaatagttgcaggaattaaa
gatctttggaaaatgatgaacataagctatgacaaatttataagaacaactgatgattat
catgtgaaagctgttcaagagattttcaaaaagttatatgatcaaggagatatatataaa
gattcttatgaaggtctttactgtactccatgtgaatcattctggacagaaactcaatta
gtaaatggaaactgccctgattgtggaagaccagttgaaaaagctaaggaagaagcttat
ttctttaaaatgagcaaatatgctgatagattaattcagtatatagaagaacatccagat
ttcattcaaccagaatcaagaaagaatgaaatgttaaataacttcttaagaccaggatta
caagatctttgtgtttcaagaacaagctttacttggggaatacctgtaagctttgatgaa
aagcatgttatctatgtttggatagatgcattatcaaactacataactgctttaggatat
ggtcaagaaaatcaagagttatacaaaaagttctggcctgctgatgttcacttaatagga
aaagatattttaagattccacacaatttactggccaataatgttaatggctttaggatta
gaattacctaagcaagtatttggtcatggatggttacttgttgatggaggaaaaatgtca
aaatcaaaaggtaacgttgttgacccagtagttttagttaatatgtttggagctgacgct
gtaagatattacttattaagagaaataccatttggttcagacggattattcaacaatgaa
atatttataaagaaagtaaatacagacttagctaatgatttaggtaacttattatcaaga
acaatagctatggtttataaatattttgatggagttattcaagcaccaacatgtaaggaa
gctattgatgatgaattaataaacttagctttatctactccaggaaaagttgaagctagc
atagatgcattaaagattccagaagctttagaaagcatatggactttaataagcagagct
aataaatatatagatgaaacaactccttggatacttgctaaggatgaagaaaagaaagaa
agactaggaacagttttatataacttattagaaactttaagatttgtttcagtaatgatt
tcaccattcttaacagaaacaagtgtaaaaataaatgatcaattaaacactaaagttaca
acttgggaaagtttaaaagagttcaatggaacagttgcaggagataaagtagttaagggt
gatgttatattcccaagaatagatgttgaggaaaaattagcagaacttgaagctttaaaa
ccagctccagttaaaccagctaacgaagagttagttaaaaatccaataaaagaagaaata
actatagatgactttgacaagatagatttaagagtagttaaagtattagaatgtgaacca
gttaaaaaagctaaaaagttattaaaacttaaggttgatttaggtggagaagaaagacag
gttatttcaggaatagcacaatactataaaccagaagagttagttggaaagtatgtagta
ttagttgctaacttaaaaccagttaaattaagaggggaattatctcaaggtatgatactt
gcagcagcaccttcagatgattcagaacttgtattagttaacccaggagaaatgttaact
ggaagccaagtaagatag

DBGET integrated database retrieval system