KEGG   Collimonas pratensis: CPter91_0226Help
Entry
CPter91_0226      CDS       T04306                                 

Definition
(GenBank) ABC transporter family protein
  KO
K02056  simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
cpra  Collimonas pratensis
Module
cpra_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:cpra00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cpra02000]
    CPter91_0226
Enzymes [BR:cpra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     CPter91_0226
Transporters [BR:cpra02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    CPter91_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DSBA RsgA_GTPase AAA_29 AAA_30 AAA_27 AAA_23 SMC_N
Motif
Other DBs
NCBI-ProteinID: AMP02625
UniProt: A0A127PYF0
Position
233940..235478
Genome map
AA seq 512 aa AA seqDB search
MTSTIPRLQIAHIRKAYPGVLANDDINLAVAPGEIHAVLGENGAGKSTLMKIIFGTVKPD
AGEIFWNGELAHIASPHVARQLGIAMVFQHFSLFDTLTVAENIALGLASDVSMAELVTQI
RQTGEKYGLELEPHRHVHTLSVGERQRVEIVRALLTKPQLLILDEPTSVLTPQAVDRLFV
TLRKLAAEGCSILYISHKLDEIRALCHSATVMRGGRVTGICDPRQETSAGLSRMMIGDEL
VRLQRERNPDSMRSERKLHLNRLCLPKAHLFATELKDIECEVRAGEIVGIAGVSGNGQQE
LLAALSGEDRRAAPNMVMLAGRAAGQLAPNPRRALGLGLVPEERLGRGAVPTLDLASNML
LSHQKAPYVKRGMIDFAYARKSAASIIERFKVKAGGPGALAKSLSGGNLQKFIVGRELER
KPSVFIVAQPTWGVDVGAAAQIHAEILALKQEGCAVLIISEELDELFALCDRLHVIAKGR
LSPSIAIEQATREQVGLWMSGLWQDTAEAAHA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcaaccataccgcgtctgcagattgcccatatccgcaaagcctatccgggtgtg
ctggccaacgacgatatcaatctcgcggtcgcgcccggcgaaatccacgccgtgctgggt
gaaaacggcgccggcaagtcgaccctgatgaaaatcatattcggcacggtcaagccggac
gctggcgaaatcttctggaatggcgaattggcgcatatcgccagtccgcatgttgcgcgc
cagctcggcatcgccatggtgttccagcacttctccttgttcgataccctcaccgtcgcg
gaaaatattgcgctcggcctggcgtctgacgtcagcatggctgagctggtgacgcagatc
cgccagaccggcgagaaatatggattggagctggagccgcaccgtcacgtacacaccctg
tcggtcggcgaacgccagcgcgtcgagatcgtccgcgccctgctgaccaagccgcagctg
ctgatcctggacgagccgacctcggtgctgacaccgcaggcggtggaccggctgttcgtc
accttgcgcaagctggccgccgagggttgcagcattctctatatcagccacaagctggat
gaaatccgcgcactctgccacagcgccaccgtgatgcgcggcggccgcgttaccggcatc
tgcgatccgcgccaggaaaccagcgccggcctgtcgcgcatgatgatcggcgacgagctg
gtgcgcttgcagcgcgagcgcaatccggattccatgcgcagcgagcgcaagctgcacctc
aaccgcctgtgtttgccgaaggcgcatctgttcgccactgaactcaaggatatcgaatgc
gaagtgcgcgccggtgaaatcgtcggcattgccggcgtttccggcaacggccagcaggaa
ttgctggcggcgctgtcaggtgaagaccggcgcgccgcgccgaacatggtgatgctggcc
ggccgcgccgccgggcaactggcgcccaatccgcgccgtgcgctcgggctcggcctggtg
ccggaagagcgactcgggcgcggcgccgtgccgaccctggacctggcgtccaacatgctg
ctgtcgcaccagaaagcgccctacgtcaaacgcggcatgatcgatttcgcctatgcgcgc
aagagcgccgcctccatcatcgagcgcttcaaggtcaaggccggcggcccgggtgcgctg
gccaagagcctgtccggcggcaacctgcagaaattcatcgtcggccgcgaactggagcgc
aagcccagcgtgttcatcgtcgcccagccgacctggggcgtggacgtcggcgccgccgcc
cagatccatgccgaaatcctcgccttgaaacaggaaggctgcgctgtgctgatcatttcc
gaagaactggatgagctgtttgcgctgtgcgaccgcctgcacgtaatcgccaagggcagg
ctgtcgccctcgatcgccatcgaacaagccacgcgtgagcaggtcggcctgtggatgagc
ggtctctggcaagataccgcggaggccgcccatgcataa

DBGET integrated database retrieval system