KEGG   Collimonas pratensis: CPter91_0566Help
Entry
CPter91_0566      CDS       T04306                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cpra  Collimonas pratensis
Pathway
cpra00071  Fatty acid degradation
cpra00072  Synthesis and degradation of ketone bodies
cpra00280  Valine, leucine and isoleucine degradation
cpra00310  Lysine degradation
cpra00362  Benzoate degradation
cpra00380  Tryptophan metabolism
cpra00620  Pyruvate metabolism
cpra00630  Glyoxylate and dicarboxylate metabolism
cpra00640  Propanoate metabolism
cpra00650  Butanoate metabolism
cpra00900  Terpenoid backbone biosynthesis
cpra01100  Metabolic pathways
cpra01110  Biosynthesis of secondary metabolites
cpra01120  Microbial metabolism in diverse environments
cpra01130  Biosynthesis of antibiotics
cpra01200  Carbon metabolism
cpra01212  Fatty acid metabolism
cpra02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cpra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPter91_0566
   00630 Glyoxylate and dicarboxylate metabolism
    CPter91_0566
   00640 Propanoate metabolism
    CPter91_0566
   00650 Butanoate metabolism
    CPter91_0566
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CPter91_0566
   00072 Synthesis and degradation of ketone bodies
    CPter91_0566
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPter91_0566
   00310 Lysine degradation
    CPter91_0566
   00380 Tryptophan metabolism
    CPter91_0566
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPter91_0566
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CPter91_0566
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPter91_0566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cpra04147]
    CPter91_0566
Enzymes [BR:cpra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CPter91_0566
Exosome [BR:cpra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPter91_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMP02961
UniProt: A0A127QRZ2
Position
584962..586146
Genome map
AA seq 394 aa AA seqDB search
MTKEVVIVGAARTAIGTFGGALKDIAPGELGAVAVKEAFARAGVDPQQAGQIIFGNVIHT
EARDMYVSRVVGINAGMSKESTALTLNRLCGSGLQAIISAANAIQLGETDVAVGGGVESM
SRALYASQAARFGARMGDIKMIDMMVGALSDPFGGGHMGITAENVAEKYGISREAQDAFA
LESQKRATAAIAAGHFKSQIVPVEIKSRKGVALFDTDEYPKADATLESLAKLKPAFKKEG
GTVTAGNASGINDGAAACVLMAADAAAQAGLKPLARVVSYGVAGVDPTIMGTGPIPAVQL
ALKRAGLSLADMAVIESNEAFAAQSLGVCKGLDLDPALTNVNGGAIALGHPLGASGTIIA
VKCLYELIRTGKRYGLITMCIGGGQGIALIIERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaagtcgtcatcgtcggcgcagcccgtacggcgatcgggacatttggcggt
gcattgaaggatattgccccgggcgaactgggtgcggttgcggtcaaggaggcgtttgca
cgcgccggcgtcgatccgcagcaggctggccagatcattttcggcaacgtcatccacacc
gaggcgcgcgacatgtatgtatcgcgcgtggtcggtatcaatgccggcatgagcaaggaa
tccaccgcgttgaccctgaaccgcctgtgcggctcgggtttgcaagccatcatcagcgcc
gccaacgccatccagctgggcgagaccgatgttgccgtcggcggcggcgtcgagagcatg
agccgtgcgctgtatgcgagccaggctgcgcgcttcggcgcccgtatgggcgatatcaag
atgatcgacatgatggtgggcgctttgtccgatccgttcggcggcggtcacatgggcatc
accgctgaaaacgtggcggagaaatacggcatctcgcgcgaagcgcaggatgctttcgcg
ctggaaagccagaagcgcgccacggcggccatcgctgccggtcatttcaagtcgcagatt
gtgccggttgagatcaagtcacgtaaaggcgtcgcgctgttcgacaccgacgaatatccg
aaggctgacgccaccctggagtcgctggccaagctcaagccggcgttcaagaaagaaggc
ggcacggtcactgccggcaatgcctccggtatcaacgacggcgctgctgcctgcgtgctg
atggcggcggacgctgccgcgcaggctggcctgaagccgctggcgcgtgtggtttcctat
ggcgtggcgggggttgacccaaccatcatgggcaccggtccgattccggcggtccagctg
gcgctgaagcgtgccggcctcagtctggccgacatggcggtgatcgaatcgaatgaagca
ttcgccgcgcaatcgctgggcgtgtgcaaagggctggacctggatccggcgctgaccaac
gtcaacggcggcgctatcgctcttggccatccgctgggcgcgagcggcaccatcatcgcc
gtcaagtgcctgtacgaactgatccgcaccggcaaacgctatggcctgatcaccatgtgc
atcggcggcggccagggcattgccctgatcatagaacgtctttga

DBGET integrated database retrieval system