KEGG   Collimonas pratensis: CPter91_1549Help
Entry
CPter91_1549      CDS       T04306                                 

Gene name
hexI
Definition
(GenBank) glycosyl hydrolase family 3 N terminal domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpra  Collimonas pratensis
Pathway
cpra00520  Amino sugar and nucleotide sugar metabolism
cpra01100  Metabolic pathways
cpra01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cpra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPter91_1549 (hexI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CPter91_1549 (hexI)
Enzymes [BR:cpra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CPter91_1549 (hexI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AMP03927
UniProt: A0A127Q1P3
Position
1595216..1596793
Genome map
AA seq 525 aa AA seqDB search
MRAALDIMAAQWRSKMNDTASKPGRSARESAGQLIMIRFPGTVLDDDTAQFLRDNHIRAV
CLFRQNMVDAAQLSKLTADLRAVMGPHALIGIDQEGGAVVRATWLPAPPAAMSLGASNDL
GLACAVGAAVARGIRSLGFNWNFAPVLDLNNNPANPVIGERSFGSDPQRATELALAWMEG
SLAEGVACCVKHFPGHGDTHVDSHRDLPTVDKPRDALDALELAPFKAAQRAPAMMSAHIV
YPALDVEHPATLSRKILTDLLRTEWDYRGVIITDGMDMHAIAGRYGVGNAAVQALAAGAD
MVMALGNRNTQEETLAALTAALSAAEEGSHLDHAGITARLARLDALATAYPCAADRYLTE
AEDQSLMAAAWRRGLTVSGNPQPLADGAKVRLLACANAAGDGVSEAGLPASAVAAMLARR
YDLELVTFDDAESFDWSTLPADGRTVILASTTRARYGARARQSWRPDLHLALWNPFQTLD
IAAPALISYGFADPALDAVADWLAGTQAAEGRIPLASVASMVFRT
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgcgctggatatcatggcggcgcaatggagaagcaagatgaatgacacagcc
agcaagcccggccgcagcgcgcgtgaaagcgccgggcaactgatcatgatccgttttccg
ggcaccgtgctggatgacgacaccgcgcagttcttgcgcgacaatcatatccgcgcagtc
tgcctgttccgccagaacatggtcgacgccgcgcagctgagcaagctgaccgctgacctg
cgcgccgtgatgggtccgcatgcgctgatcggcatcgaccaggaaggcggcgcagtggtg
cgcgcgacctggctgccggcgccgccggcggcgatgtcgctgggcgccagcaatgacctg
gggctggcctgcgcagtcggggctgcggtggcgcgcggcatccgttcgctcggcttcaac
tggaatttcgcaccggtgctggacctcaacaataatcccgccaacccggtgatcggcgag
cgttccttcggttccgatccgcagcgcgccaccgaactggcgctggcctggatggaaggc
agcttggcggaaggcgtggcttgctgcgtcaaacactttcccggccacggcgacacccac
gtcgattcgcaccgcgacctgcccaccgtcgacaagccgcgcgacgcgctggatgcgctg
gagctggcgccgttcaaggcagcgcagcgggcgccggccatgatgagcgcgcacatcgtc
tatccggcgctggatgtcgagcatccggccaccttatcgcgcaagatcctgaccgatctg
ctgcgcaccgaatgggattatcgcggcgtcatcatcaccgacggcatggacatgcacgcc
atcgccggccgctacggcgtcggcaatgccgcggtccaggccctggcggccggcgccgac
atggtcatggcgctcggcaaccgcaacacccaggaagaaacgctggcggccttgacggcg
gcgctgtccgcagccgaggagggcagccatcttgaccacgccggcataactgcccgcctg
gcccgtctcgatgccctggcgacggcctatccgtgcgccgctgatcgctatctgaccgaa
gccgaggaccagagcctgatggcggccgcctggcgccgcggcctgaccgtgagcggcaat
ccgcagccgctggcggacggcgccaaggtgcgcctgctggcctgcgccaatgccgccggc
gacggcgtttccgaagccggcttgccggccagcgcggtggctgccatgctggcgcgccgc
tacgatctcgagttggtgacttttgacgatgctgaaagtttcgactggagcacgctgccg
gccgacggccgcaccgtgatcctggcttccaccacgcgcgcgcgctacggcgcccgggcg
cgccagagctggcgtcccgatctacacctggcgctgtggaatccgttccagaccctggac
atcgccgcgccggcgctgatcagctacggcttcgccgatcccgcgctggacgccgtggcc
gactggctggcgggaacccaggccgcggaaggccggattccgctggcgtccgtggctagt
atggtgtttcgcacataa

DBGET integrated database retrieval system