KEGG   Collimonas pratensis: CPter91_5123Help
Entry
CPter91_5123      CDS       T04306                                 

Gene name
gatC
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cpra  Collimonas pratensis
Pathway
cpra00970  Aminoacyl-tRNA biosynthesis
cpra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpra00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CPter91_5123 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cpra03029]
    CPter91_5123 (gatC)
Enzymes [BR:cpra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CPter91_5123 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CPter91_5123 (gatC)
Mitochondrial biogenesis [BR:cpra03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CPter91_5123 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: AMP07411
UniProt: A0A127QBM5
Position
5280047..5280349
Genome map
AA seq 100 aa AA seqDB search
MSLALSDVKRIANLARLELTDGQAASTLDKLNGIFSLVEQMRAVDTTGIEPLSHPIAAIR
HDLSLRLREDEVTEPNRREEYQKVAPATEDGLYLVPKVLE
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgtcattagccctttccgacgttaagcgcattgccaatttagcacgcctggaactcacc
gacggccaagccgcctccacgctggataaattgaacggtattttttcgctggtggagcag
atgcgcgcggtggacaccaccggcatcgagccgctcagccatccgattgccgccatccgc
cacgatctttccttgcgcctgcgcgaggatgaagtgaccgagccgaaccggcgcgaagag
tatcaaaaggttgccccggcgaccgaagacggcctgtacctggtgcccaaagtcctcgaa
taa

DBGET integrated database retrieval system