KEGG   Collimonas pratensis: CPter91_5323Help
Entry
CPter91_5323      CDS       T04306                                 

Definition
(GenBank) NAD binding domain of 6-phosphogluconate dehydrogenase family protein
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
cpra  Collimonas pratensis
Pathway
cpra00260  Glycine, serine and threonine metabolism
cpra00620  Pyruvate metabolism
cpra00630  Glyoxylate and dicarboxylate metabolism
cpra01100  Metabolic pathways
cpra01110  Biosynthesis of secondary metabolites
cpra01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPter91_5323
   00630 Glyoxylate and dicarboxylate metabolism
    CPter91_5323
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPter91_5323
Enzymes [BR:cpra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     CPter91_5323
    1.1.1.81  hydroxypyruvate reductase
     CPter91_5323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AMP07609
UniProt: A0A127QC11
Position
complement(5491187..5492128)
Genome map
AA seq 313 aa AA seqDB search
MKLLCYVPPGSDFETWIADFGKALPQADIRFWQEGDNAPADYALVWRPPAAMLQGRQDLK
AIFNLGAGVDAILKLGDALPAGVPLVRIEDGGMAIQMASYVTHAVLGYFGRYDIYRQQAA
RREWQPLPEPDKRAFSVGILGLGVLGSRIAAALHHFEFPLNGWSRTPKDLPGVRNFVGDD
ALDDFLRASRVLVCILPLTDATRGIVNRENLQKLQKGEEGAYLINVARGGHVVEADLLAL
IQEGQVAAATLDVFEQEPLAPDHPFWQEPRISITPHISAITVDADSVRQISDKIRQLEQG
KVVSGIIDRGNGY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactcctgtgttacgtacccccaggcagcgatttcgaaacctggatcgcagacttc
ggcaaagccctgccgcaagccgacatccgcttctggcaagagggcgacaacgctcctgcc
gattacgccctggtgtggcgcccgccggcagccatgctgcaaggacgccaggatctcaaa
gcgattttcaacctcggcgccggcgtcgacgccatcttgaaactgggcgatgcgctaccg
gccggcgtgccgctggtccgcatcgaggacggcggcatggcgatccagatggccagctat
gtcacgcatgccgtgctcggctatttcggccgttacgatatttaccggcaacaggctgcg
cggcgtgaatggcagccgctgccggagccggacaagcgtgcattcagcgttggcatcctc
ggccttggcgtgctcggctcgcgcatcgccgcggcattgcatcattttgagtttccgctg
aatggctggagccgcacgccaaaggatttgccgggtgtgcgcaactttgtcggcgacgac
gcgcttgacgatttcctgcgcgcctcgcgggtgctggtctgtatcctgccgctgaccgac
gccacgcgcggcatcgttaaccgggaaaacctgcagaaactgcagaagggcgaagagggc
gcatacttgatcaacgttgcccgcggcggccatgtggtcgaggcggacctgctggcgctg
atccaggaaggccaggtcgccgcggcgacgctggacgtgttcgagcaggaaccgttggcg
cccgatcatccgttctggcaagagccgcgcatcagcattaccccacacatttcggccatc
accgtagatgccgattcggtgcggcagatcagcgacaagatcaggcagctggaacaaggc
aaggtggtgagcggtatcattgatcgcggcaacggctactaa

DBGET integrated database retrieval system