KEGG   Anaerotignum propionicum: CPRO_04190Help
Entry
CPRO_04190        CDS       T04574                                 

Gene name
dnaE2
Definition
(GenBank) error-prone DNA polymerase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cpro  Anaerotignum propionicum
Brite
KEGG Orthology (KO) [BR:cpro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CPRO_04190 (dnaE2)
Enzymes [BR:cpro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     CPRO_04190 (dnaE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AMJ40028
UniProt: A0A110A6T2
Position
complement(449211..450095)
Genome map
AA seq 294 aa AA seqDB search
MKKSGIIDLHTHSYFSDGTFSPEELILLAKEQGLCAVALTDHDTIKGLEEFIIAGKKHGI
ETIPGIELAAQWGRFHQPELHIVGLGFDPKAAIWAEQMESFVQNRTIRNIKMVEQLTQIG
LPITLEEVTENAGGEIVTRAHFANVLLKKGYIRIRDEAFSKYLTQGRPGYVAKVLPTPTS
CIQTIHSAGGISILAHPTLYNLAQDQLDALCQELVPLGLDGIECFYSTFSPSQRKNMMKL
AKKHHLYPSGGSDFHGKNKPLIRLGSGRGNLAIPYSLWENMQTHMKALKENPFL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagcggcatcatcgatctacacacccattcttatttctcagatggtaccttt
tcgccagaggaactcattcttttggcaaaagaacaaggactttgcgctgtggctctcact
gaccacgataccataaaagggttggaggagtttattatagcagggaaaaaacatggtata
gaaacgataccggggattgagctggccgcccagtgggggcgctttcatcaacccgagctg
catattgtaggtcttggattcgatcccaaggcagcaatttgggcagagcaaatggaatct
tttgtgcaaaatagaaccatccgaaatataaaaatggtagagcagttaacccaaatcggg
ttgcccattaccctagaggaagtaacagaaaatgcaggaggagaaatcgtaacccgtgct
catttcgccaatgtccttttaaaaaaaggttatattcgtatacgagacgaagcattttca
aaatatcttacccaaggtcgccctggctatgttgcaaaagtactgccaacccccacatct
tgcatccaaacaatccactccgccggaggaatcagtattctggctcaccctaccctttat
aatcttgctcaggatcaattggacgctttgtgtcaagaattggtgcctctgggtttagat
gggatagaatgtttctattcaaccttctcaccttctcaaagaaagaacatgatgaaatta
gccaaaaaacatcatctgtacccgtcgggaggcagtgactttcacggaaaaaacaaaccc
ctcattcgtttaggttcaggtaggggaaacttagccatcccctattccctttgggaaaat
atgcagacccatatgaaagctttgaaagaaaatccttttttatga

DBGET integrated database retrieval system