KEGG   Candidatus Cyclonatronum proteinivorum: CYPRO_2788Help
Entry
CYPRO_2788        CDS       T05709                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cprv  Candidatus Cyclonatronum proteinivorum
Pathway
cprv00480  Glutathione metabolism
cprv00590  Arachidonic acid metabolism
cprv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cprv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CYPRO_2788
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CYPRO_2788
Enzymes [BR:cprv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CYPRO_2788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AXJ02027
UniProt: A0A345UNH5
Position
complement(3628494..3629027)
Genome map
AA seq 177 aa AA seqDB search
MLSGTVIPSAGSDQNPEKGIFDFTMTTLSGEEKDLSQFKGSVVLIVNTASKCGFTSQYRE
LQQLYETYADRDFTILGFPSADFGGQEFEADEDIAAFCERNFGVTFPMFSRISVRGAEQH
PLFTLLTSSPNPDTEGDIRWNFEKFLLDQQGNLIRRFGSRTNPMHTDVTASIDALLE
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgctttccggaacagttatcccgtctgcgggctctgatcaaaatcctgaaaaaggcatt
tttgatttcaccatgaccaccctcagcggggaagaaaaagacttgagccagtttaaaggc
tccgttgtgctaatcgtgaacacggcttcaaagtgtggttttacatcccaatatagggaa
cttcagcagttgtatgaaacctatgctgaccgtgactttaccattcttggttttccgtca
gccgactttggcggacaggagtttgaggccgatgaagatatcgcagccttttgtgagcgc
aatttcggggtaaccttccctatgttcagccgcatttccgtgcgcggtgcagaacagcat
cctttatttaccctgttaaccagcagccctaatcctgatacagagggggacattcgctgg
aattttgaaaaatttctgttggatcagcaaggcaacctcatccgtaggttcggctcaagg
accaaccctatgcatacggatgttaccgcaagtattgacgcgctgcttgaataa

DBGET integrated database retrieval system