KEGG   Candidatus Cyclonatronum proteinivorum: CYPRO_3124Help
Entry
CYPRO_3124        CDS       T05709                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
cprv  Candidatus Cyclonatronum proteinivorum
Pathway
cprv00250  Alanine, aspartate and glutamate metabolism
cprv00330  Arginine and proline metabolism
cprv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cprv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CYPRO_3124
   00330 Arginine and proline metabolism
    CYPRO_3124
Enzymes [BR:cprv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     CYPRO_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXJ02359
UniProt: A0A345UPF7
Position
4032590..4034215
Genome map
AA seq 541 aa AA seqDB search
MSTAYFEVPKPYNEPYLSYAPGTPERDKLKQALSELRAKEVEIPVIIGGKRIFTGRTQDV
VMPHNHKHKLGVVHKAGPEEVKLAIASCLEAREAWANMPWEHRASILLKAADIITGPERY
RANAATMLGQSKTPHQSEIEAVGELADFFRFNAYYLTRIMGDQPSSPKETWNRVEYRGLE
GFMFAVTPFNFTAIAGNLPTSMALCGNAVIWKPATSSVYSSYFVMEVLERAGMPPGVINF
LPGDGADVGDAVFADPNLCGLQFTGSTGTFQRMWHTIGSNIQNYKTYPRIVGETGGKDFI
FMHPTADVREVSVAALRGAFEFQGQKCSAASRMYVPASKWDALREDLLAEVAQIKMGDVE
EFDTFMGAVIDKKAFDSITQYIDHAKGSDEAEILAGGRYDDSVGFFVEPTVILTSNPRFK
TMEEEIFGPVLTIYVYEDDKLDEALTLCDTTSPYALTGAIFAKDRYAVTMMADRLRHAAG
NFYINDKPTGAIVDQQPFGGGRASGTNDKAGSMQNLLRWLSARSIKENLNPPTDWRYPYM
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagcctattttgaagtccccaaaccctacaatgagccatacctgagctatgcg
cccggcacgcctgagcgcgacaaactgaagcaggccctttcagagcttcgcgcgaaggaa
gtagaaattccggtcatcattggtggcaaacgcatattcaccggccgcacgcaggatgtg
gtgatgccacacaaccacaagcacaagctgggtgtagtgcacaaggcgggacccgaagaa
gtgaaacttgccatcgcaagctgtcttgaggcccgcgaagcctgggcgaacatgccgtgg
gagcaccgggcgtccatcctgcttaaggccgcagacatcatcaccggacccgagcgctac
cgtgcgaacgcggcgaccatgctggggcagtccaaaaccccgcatcagtccgagattgag
gccgtaggcgagctggccgatttcttccgcttcaatgcctactacctcacccgcatcatg
ggcgatcaaccctcctccccgaaagagacctggaaccgggtcgaataccgcggcctggaa
ggcttcatgtttgccgtaacgcccttcaacttcacggccattgcgggcaacctgccgacc
tccatggcgctctgcggcaacgcggtaatctggaaaccggccacaagctccgtgtactcc
agctattttgtgatggaagtgctcgagcgtgccggcatgcctccgggcgtgatcaacttc
ctgcccggcgatggcgcagatgtaggcgacgctgtcttcgctgatcccaacctgtgcggg
ctgcagttcaccggctcaaccggcacctttcagcgtatgtggcacaccattggctccaac
atacagaactacaaaacctacccgcgcatcgtaggcgaaaccggcggcaaggatttcatc
ttcatgcacccaaccgccgatgtacgcgaagtttcggttgccgccctgcgcggtgccttc
gagtttcagggacagaaatgctcggcagcctcccgcatgtacgtgcccgcttccaaatgg
gacgccctgcgtgaagacctgctggccgaagtcgcacagatcaaaatgggcgatgtggaa
gagttcgacaccttcatgggtgccgtaattgataagaaagccttcgacagcatcacccaa
tacatcgatcatgccaagggaagcgatgaggccgaaattctggccggcggccgctacgat
gacagcgtgggctttttcgttgaaccgaccgtgattctcacaagcaatccgcgcttcaaa
acgatggaagaagaaatctttggtccggtgctcaccatctacgtctatgaagacgacaag
ctggatgaagccctcacgctttgcgacacaacctcgccctatgccctgaccggcgccatt
ttcgccaaagaccgctacgcagtgaccatgatggccgaccgtctgcgacatgcggcgggc
aacttctacatcaacgacaagccgaccggcgccatcgtggatcagcagcccttcggcggc
ggacgtgcatccggtaccaacgacaaggccggctccatgcaaaacctgctgcgctggctc
tccgcccgatccatcaaagaaaacctcaatccgcccaccgactggcgctacccctacatg
ggctaa

DBGET integrated database retrieval system