KEGG   Colwellia psychrerythraea: CPS_0330Help
Entry
CPS_0330          CDS       T00258                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00230  Purine metabolism
cps00250  Alanine, aspartate and glutamate metabolism
cps01100  Metabolic pathways
Module
cps_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CPS_0330 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPS_0330 (purA)
Enzymes [BR:cps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CPS_0330 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AAZ25616
UniProt: Q48A17
Position
341139..342434
Genome map
AA seq 431 aa AA seqDB search
MGKNVVVLGTQWGDEGKGKIVDLLTDKAKYVVRYQGGHNAGHTLVIDGEKTVLHLIPSGV
LRDNVKCLIGNGVVLCPKALMTEITMLEAKGVPVRERLLISDACPLILPYHNALDVAREV
ARGNKAIGTTGRGIGPAYEDKVARRGLRVGDLFCAETFAAKLKEIVEYHNFSLVNYYKVE
PVNYEEVLADALAVADTIKKMTADISEILDQARIAGESIMFEGAQGTLLDIDHGTYPYVT
SSNTTAGGVATGCGVGPRHLDYILGITKAYTTRVGSGPFPTELDDEVGNHLGTVGHEFGA
TTGRERRCGWFDAVAMHRAIQVNSVTGFCLTKLDVLDGLETLKICTGYKTEAGDIITVPP
TAAEGYDKITPVYEEMPGWTESTVGATSVDVLPENALAYIKRIEEITGIPVDIISTGPDR
VETIIKVNPFL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaatgtagttgttctcggcactcaatggggtgacgaaggtaaaggtaagatc
gttgacttactaaccgataaagctaaatacgtagttcgttatcaaggtggtcacaatgct
ggtcatactttagtaattgacggtgaaaaaaccgtattacatcttattccatcaggcgtt
ttacgtgataacgtaaaatgtttaattggtaatggtgtagtgctatgtcctaaagcatta
atgacagaaatcaccatgctagaagcaaaaggcgtacctgtacgtgaacgtttgcttatc
agcgatgcttgtccattgattcttccttatcataatgctttagatgttgcgcgtgaagtt
gctcgcggtaataaagctattggtactacaggtcgtggtattggccctgcatatgaagat
aaggttgcacgacgtggtttacgcgttggtgatttattctgtgcagagacatttgcggct
aaactaaaagaaattgttgaatatcataacttctcattggttaactactataaagttgag
ccagtgaattatgaagaagtactagctgatgcactagctgttgctgatacgattaaaaaa
atgaccgctgatatctcagagattttagaccaagcccgcatagccggcgaatctattatg
tttgaaggtgctcaaggtactttacttgatatcgaccacggaacttatccttacgtaact
tcgtcgaatactactgctggtggtgttgctacagggtgtggcgttggtcctcgtcactta
gattacattttaggtatcaccaaagcttacactacacgtgtaggttcaggtcctttccct
acggaattggatgatgaagttggtaaccacttaggtactgtaggtcatgaatttggtgca
actacaggacgtgagcgtcgttgtggctggtttgatgctgttgcaatgcatcgtgctatt
caagtaaatagtgtaacaggtttctgtttaactaagcttgatgtactagatggattagaa
acattaaaaatctgtacaggttacaaaactgaagctggtgatattatcactgtaccgcct
acggcagctgaaggttatgataaaatcacgcctgtatatgaagagatgccaggttggact
gaaagcactgttggtgcaacatcagttgatgttttacctgaaaatgcccttgcttatatc
aagcgaattgaagaaattaccggtataccagtagacattatctctaccggtcctgatcgt
gttgaaacgattattaaagtgaacccttttctttaa

DBGET integrated database retrieval system