KEGG   Colwellia psychrerythraea: CPS_0768Help
Entry
CPS_0768          CDS       T00258                                 

Gene name
selD
Definition
(RefSeq) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00450  Selenocompound metabolism
cps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CPS_0768 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cps03016]
    CPS_0768 (selD)
Enzymes [BR:cps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CPS_0768 (selD)
Transfer RNA biogenesis [BR:cps03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CPS_0768 (selD)
 Prokaryotic Type
    CPS_0768 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AAZ25295
UniProt: Q488J7
Position
786206..787240
Genome map
AA seq 344 aa AA seqDB search
MTSIRLTQYSHGAGCGCKISPSVLDVMLKSSLALPVNDALLVGNSTKDDAAVFDIGNDQG
VISTTDFFMPIVDDPTDFGKIAACNAISDIYAMGGKPIMAIAILGWPVNLLAPEIAQQVL
DGARAICAEAGIPLAGGHSIDAPEPIFGLAVTGLINNAHIKRNNTAEVGDLLYLTKPLGI
GIMTTAEKQGKLLPEHAQLAPQAMKTLNVIGQKFAELEVVTAMTDVTGFALLGHLLEMCQ
GSGVAAVIDFEQVPRLDFVNDYIDQGCVPGGCERNFISYGEHVGPLSPKQKILLCDPQTS
GGLLVAVKPQGKEAFEALCQENGLNLQPIGELVAATSPTVSLLS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaattcgcttgactcaatactcacacggcgcaggctgtggctgtaaaatttct
ccatcggtacttgatgtgatgctaaagtcatcacttgctttacccgtgaatgacgcactt
ttagtgggtaatagtactaaagacgatgcggccgttttcgatattggtaatgatcaaggt
gtgatttcaaccactgatttctttatgcccattgttgatgacccaactgactttggtaaa
attgctgcctgtaatgccatcagcgatatttatgccatgggcggaaaaccgatcatggcg
atagctattttgggctggccagtcaatcttttagcacctgaaattgcccaacaagtactt
gatggcgctagagctatctgtgctgaagcgggtatcccgttagcaggcggtcattccatt
gatgcgccagagcctatctttggtttagcggttacgggactaattaataatgcgcacatt
aagcgaaataatactgcagaggttggcgatcttctgtacttaaccaagccattaggtatt
ggcattatgaccacggctgaaaaacaagggaaattgttacctgaacatgcgcaactagca
ccacaagcgatgaagaccctaaatgtcattggacagaagtttgcagaactagaggtagtt
actgctatgaccgatgtaaccggttttgcactattaggacaccttttagaaatgtgtcag
ggcagtggggttgctgcagttattgattttgagcaagtaccgcgtcttgatttcgtcaat
gattacattgatcaaggttgcgtacctggtggttgtgagagaaactttatcagctatggc
gagcatgttgggccgttaagccccaaacaaaaaatacttttgtgtgaccctcaaaccagt
ggtggtttacttgtggcagtgaaaccacaaggcaaagaagcttttgaagcgttatgccaa
gagaatggtcttaatctacaacctattggtgaactcgtggcggcaacttcgcctacagtg
agtttgttgtcatga

DBGET integrated database retrieval system