KEGG   Colwellia psychrerythraea: CPS_0791Help
Entry
CPS_0791          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SnoaL
Motif
Other DBs
NCBI-ProteinID: AAZ24406
UniProt: Q488H5
Position
complement(811520..811939)
Genome map
AA seq 139 aa AA seqDB search
MNSFDVAIKFFEACEAPLGWEGCKQYVQEGALFSAQSEPLAEINSVHAYCDWMHGFGTVI
SPEGSYELHSSSYNESSNTAIFFATYHGKHTGEGGPVPPTNKETHTHYVYIIKMGDDSKV
SEMTKVWNAPWAMKELGWM
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaactcatttgacgtagcaattaaattcttcgaagcatgtgaagctccactcggatgg
gaagggtgcaagcagtatgtacaagaaggtgccttattctcagctcaaagcgaaccactt
gccgaaatcaactctgtccatgcgtactgtgattggatgcacggatttggtacggttata
tctcctgaaggttcgtatgaactacattcatcaagctacaatgaaagttcaaatacagca
atattcttcgcaacgtatcatggtaagcatactggtgaaggtggacctgtgccaccaacg
aacaaagaaactcatacacattatgtctacattataaaaatgggcgacgattcgaaagtc
tcagaaatgactaaagtttggaatgccccttgggcaatgaaagagcttgggtggatgtag

DBGET integrated database retrieval system