KEGG   Colwellia psychrerythraea: CPS_0796Help
Entry
CPS_0796          CDS       T00258                                 

Definition
(RefSeq) conserved hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB DinB_2
Motif
Other DBs
NCBI-ProteinID: AAZ26729
UniProt: Q488H0
Position
813576..814130
Genome map
AA seq 184 aa AA seqDB search
MITSQLEIIKQGQRYLNTVSKKDYSAIMSPNFMSSAGSHMRHIIDHYLAIMSGLHNEVID
YDSRVRGGQLESSPQLAIDKLNEISMWLKSLCEDELSKMIILSTEVSVTHKNVKKVKTSV
ARELVFAGSHAVHHYAMITQISFAQQSTLQTKALPECFGLASATATFLRQNDVLPRDEYL
VISK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgagccagttagagattattaaacaaggtcagcggtaccttaataccgtctct
aaaaaagactatagcgcaattatgtcgcctaactttatgagttctgcaggttcgcatatg
cggcatattattgatcattatttggcgataatgtctggtctacacaatgaagttattgac
tatgatagtagagtgagaggcggtcaattagagtcatcaccacaacttgcaatagacaaa
ttaaatgaaataagtatgtggcttaaaagtctttgtgaagatgaattgagtaaaatgata
atattatcaactgaagtttcagtgacacataaaaatgttaaaaaagtgaaaacttcggtt
gctagagaactcgtctttgctggcagccacgcagtacatcattacgccatgataactcaa
atatcatttgctcaacaaagcactttgcaaaccaaagcgttacctgaatgttttggtcta
gcctctgcaacggctacctttttgagacaaaatgatgtacttcctcgtgatgaataccta
gtaatcagtaaataa

DBGET integrated database retrieval system