KEGG   Colwellia psychrerythraea: CPS_0824Help
Entry
CPS_0824          CDS       T00258                                 

Definition
(RefSeq) oxidoreductase, short-chain dehydrogenase/reductase family
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase 3HCDH_N Shikimate_DH TrkA_N Eno-Rase_NADH_b THF_DHG_CYH_C FAD_binding_3 NmrA
Motif
Other DBs
NCBI-ProteinID: AAZ26050
UniProt: Q488E2
Position
838732..839499
Genome map
AA seq 255 aa AA seqDB search
MNFTHQGKAIIIGGSSGMGLATAKLLVKHNVEVIIVGRNAEKLELALTQLNETGKASAIQ
ADLYQTEDLEKLLSYINQEDVHLSYLVNAAGYFSPKAFLAHEGDDYNTYMDLNRATFFIA
QAVAENMKKQGGGNIVNIGSMWGQQAIKATPSSAYSMAKAGLHALTQHMAMELAEDNIRV
NAVSPAVVKTPIYHSFIDPSTLDEALAGFNEFHPIGRIGTADDVANTIGFLLSSDTSWVT
GAIWDIDGGVMAGRN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaattttacccatcaaggaaaagcaataattattggtggctcaagcggtatgggctta
gcaacagcaaaactattagttaaacataatgtcgaggttattattgtcgggcgtaatgct
gaaaaacttgaactagcattaacccaacttaacgagactggaaaagcatcggcgattcaa
gcggatctttatcaaaccgaggatttagaaaaattgctgtcgtatattaatcaagaggat
gttcatttaagttatttggtgaatgccgctggatattttagtcctaaagcatttttagcg
catgaaggtgatgattataatacctacatggatctcaacagagcgacattctttattgct
caagccgttgctgaaaatatgaaaaaacagggcggtggtaacattgtaaatatcggttca
atgtggggacaacaagcgattaaagcgacaccatcttcggcttattctatggcaaaggct
ggtttacacgcgttaactcaacatatggcaatggaactagcagaagataatattcgtgtt
aatgcggtatctccagcggtagtaaaaacacctatctatcactcttttattgaccctagt
acattagatgaagctctggctggatttaacgaattccacccaattggaagaataggtact
gcggatgatgtggctaatactatcggctttttattatcatcggatacttcttgggtaaca
ggggctatttgggatattgatggtggtgttatggcggggcgtaattaa

DBGET integrated database retrieval system