KEGG   Colwellia psychrerythraea: CPS_0825Help
Entry
CPS_0825          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ24975
UniProt: Q488E1
Position
839471..839602
Genome map
AA seq 43 aa AA seqDB search
MVVLWRGVIKSKDNYSLLGRDNSMRKSYCVISIYNSVAFILSY
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgttatggcggggcgtaattaaatctaaagataattacagcttgttaggcaga
gataactcaatgagaaagagctactgtgttatctctatatataactcagtagcttttatt
ttgtcatactaa

DBGET integrated database retrieval system