KEGG   Colwellia psychrerythraea: CPS_0827Help
Entry
CPS_0827          CDS       T00258                                 

Definition
(RefSeq) putative glutaredoxin
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 Glutaredoxin GST_N_2 GST_N
Motif
Other DBs
NCBI-ProteinID: AAZ26386
UniProt: Q488D9
Position
complement(841106..841375)
Genome map
AA seq 89 aa AA seqDB search
MTLSAIQPNDMALYHYDSCPFCAKTRHAINELDLNIELRNIQKNHQHRIELQQGGNKTQV
PCLRIGQSNGKAQWLYESGDIINFLRNRK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgactttatcagcaatacagccaaacgacatggcactttatcattatgacagctgtcct
ttttgcgctaaaacacgccatgcaataaatgaacttgatctcaatattgaactacgaaat
attcaaaaaaaccatcagcaccgcattgaactgcaacaagggggtaataaaacacaagta
ccttgtttacgtataggacaatcaaacggtaaagcgcaatggttatatgaatccggtgac
attattaactttttacgcaatagaaaataa

DBGET integrated database retrieval system