KEGG   Colwellia psychrerythraea: CPS_0831Help
Entry
CPS_0831          CDS       T00258                                 

Definition
(RefSeq) transcriptional regulator, LysR family
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: AAZ28529
UniProt: Q488D5
Position
843350..844240
Genome map
AA seq 296 aa AA seqDB search
MDTLDGLKTVVAVVETNSFTAASDRLGISKALVSKYVGEVENQLGIRLFNRTTRQLALTD
SGRRYYEEAIILLEQFSAMVDNVTGEQTAPRGLLRISAPVTFGEMRLAPLLPKFIALYPD
LTVELVLTNGAIDMLEEGIDVRLRIGGVDDSNMIARHLTNFPLVLSASPNYAQTQGLPTT
PEQLGEHHCIIDSNFRIGKQWPFISPKGRAETINVQSGLAVNSPQAVREIAIADGGIAMT
PNFIVEDALADGRLLRVMPEYTTLEFGLFAIYPHRKYVARKVRCFIDFVLEQFSKK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggatacgttagatggattaaaaacagtggtagcagtcgttgaaacaaactcatttacg
gcggcaagtgacaggctagggatctcaaaagcgttagtaagtaagtacgtaggtgaggtt
gaaaaccaattaggaattagactctttaatcgcacaaccaggcagttggcattaactgac
tccggccgacgttattatgaagaagcaatcatattacttgagcagtttagcgctatggta
gataacgtcaccggtgagcagaccgcaccacggggtttattacgaattagcgcaccggta
acttttggtgaaatgaggttagcacctttattaccaaagtttattgccttatatcctgac
ttaaccgttgagttagtgctaaccaatggtgcgatagacatgctggaagaggggattgat
gtgcgtttacgtattggcggtgtagatgactccaacatgatagcaaggcatttaactaat
tttcctctggtattgtcggcatcaccaaattacgctcaaacgcaaggtttacctacaacg
cccgaacagcttggagaacaccattgtattattgatagtaattttaggattgggaaacaa
tggccgtttatttcgccaaaggggcgagcagaaactattaatgttcagtctggcttagcg
gtaaatagcccgcaagccgttagggaaatagccatcgctgatggtgggattgcgatgaca
cctaactttattgtcgaagacgcattagctgatggcaggctgttaagagtaatgccagaa
tacaccacgctggagtttggtctttttgctatttacccacaccggaagtatgtggctaga
aaagtacgttgttttatcgactttgtcttagagcagttctccaaaaaatag

DBGET integrated database retrieval system