KEGG   Colwellia psychrerythraea: CPS_0832Help
Entry
CPS_0832          CDS       T00258                                 

Definition
(RefSeq) conserved hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2219
Motif
Other DBs
NCBI-ProteinID: AAZ24889
UniProt: Q488D4
Position
complement(844312..845268)
Genome map
AA seq 318 aa AA seqDB search
MGSVAVAEEYNTGSISLSLDNDGFLGSDRGYTNGLFFKFNSNSTVDIEQSSPLLLKTVGS
WLPLHHQTNKGWGITLGQQIWTPTDLESPVEGENDRPYTGFLFIEANIFEFSADTANKYS
LMLGAVGPDAFGENSQKSVHSLIGSPKPMGWARQIENQTVFNFSYEGQRLLTRAPGWLGK
DYDSGFSGRVNVGNYQSEIALGSTIRWGTSLHESFASVGVMPGNYIDVSVLSKSRSGQFY
YLAVEGRYRFQDITIDGARPKHLFDVHTEHWQATISTGAVYYQESWGLAFSIITSSPDYK
EDLRKYNSTASLEVFWRA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgtcgctgttgcagaagaatacaatactggcagtatcagcctaagccttgat
aacgatggctttcttggctctgatagaggatacaccaatggactatttttcaaattcaat
tcaaacagtaccgttgatatagagcagagctccccgttgctgcttaaaaccgttggtagt
tggttacccttacatcatcagaccaacaaaggttggggtatcactcttggtcaacaaata
tggacgccgaccgacttagaatctcctgttgaaggagaaaacgatagaccctacaccgga
tttttgtttattgaagcgaatatttttgaattttcagcggatacagccaataaatacagc
ttgatgcttggggccgtaggtcctgatgcttttggtgagaattcacaaaagtctgttcac
agtttaataggctcaccaaaacctatgggttgggctagacaaattgaaaatcaaacagtg
tttaacttttcttatgaaggccaaagattgttgactagagcaccaggttggcttggtaaa
gactacgatagcggcttctcaggtagagttaatgttggtaattatcaaagtgaaattgca
ttgggtagtaccattagatggggcacttctttacatgaaagtttcgccagtgttggggtt
atgccaggcaattacattgacgtcagtgttttgtcaaaaagtcgctccggacaattttac
tatcttgcagtagaagggagatatagatttcaagacattactattgatggcgcgcgccct
aagcatttatttgatgtgcatactgaacattggcaagccacgatatctaccggtgccgtt
tattatcaagaatcatggggattagcttttagtattattaccagttctcctgactataaa
gaagacctacgtaagtacaattctaccgcgtcgcttgaagtattctggcgtgcttaa

DBGET integrated database retrieval system