KEGG   Colwellia psychrerythraea: CPS_0838Help
Entry
CPS_0838          CDS       T00258                                 

Definition
(RefSeq) aminotransferase, class V
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Rhodanese Lactamase_B
Motif
Other DBs
NCBI-ProteinID: AAZ27533
UniProt: Q488C8
Position
complement(851096..853432)
Genome map
AA seq 778 aa AA seqDB search
MMNLPKNIQQPLSLIYLDANATTQVLPQAASAALSTMETLFGNPSSSHISGLQAKQIVDK
TRQQAKRIVGAAEGKIIFTSGATEGIQTAILSALVNVKKTLNKSLNNKSYSLLYGATEHK
AVPESLKHWNKILEINAEIKAIPVDEKGQLDMAFIAKEVPNALMVCTMAVNNETGVYQDI
SLLDQTIRTNNPNVAWMVDCVQALGKTDLVLAQTSIDYAPFSGHKLYAPKGIGFMYVKEK
APFTAFIAGGGQESGLRSGTENLPGLAALSEIFSMLLGESEASFTPIKTLHLYRQQLVSA
LTQAFPEITFNHSFENSVATTLNFAIPGFSSKEIMDLFDAANIRVSSGSACSSKVTRSFV
LDAMGLPAWQSESAIRMSFGPAMTQTEIDIACSRIVSAAQALVQSCLTLDKKNIDTQTMN
TSSTTNKTELDGLVQFKAGGSCSWLYVDKKTRSAVFIDPLSEVSERLQTLLTCRGLNLVA
VIDTHGHADHKSCRNGIAKKFLAEQQTEYLGWPAGAQTTTIHGQTFQYLILGDKWLIKVA
TPGHTDDSMSLLLCDPVTDSAEKLQVHYAFCGDLILMDSIGRSNFSTSSAPAMYSSLKLM
KSLIGNNSLICPSHDYHNEFTTCLETEMKRNSLLRQVINSEIDIEEFTSKKIKMDKDIIN
ESGSEIMCGALIGACQKVVVREYDSASLTKAVKKSSDMKLIDIREPHEYALQHDEKFTSN
VPLTRLVQFVKEQQQNKEQEFVLVCRSGGRSQLAAQALARLGFENVGHLKGGYALHQY
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttaccaaaaaacattcagcaaccactcagcctaatttacctcgatgccaat
gcgaccactcaagtattaccacaagctgcatctgcagcactatcaaccatggaaacactc
ttcggcaatcccagcagtagtcatatttctgggctacaagccaagcagatagtagataaa
acacgccaacaagcaaagcgcattgttggcgctgctgaaggtaaaatcatcttcaccagt
ggtgcaactgaaggtattcaaacagcaatactatcggcattagtgaatgttaagaaaacg
cttaataagtctcttaataacaaaagctatagccttttgtatggcgcaactgaacacaaa
gctgtgccagagtcgctaaagcactggaacaaaattctggagataaatgctgaaatcaaa
gcgattcctgttgatgaaaaaggccaattagatatggcatttatcgctaaagaagtgcct
aacgctttgatggtttgtactatggcggtcaacaatgaaactggtgtttatcaagatata
agtttactagaccaaacaatacgtaccaataatcccaacgtagcgtggatggtagattgc
gtgcaagctttaggtaaaacagacctagtcttagcgcaaacaagtattgattatgcacct
tttagtgggcacaaactctatgctcccaaaggtatcggttttatgtatgttaaagaaaaa
gcaccattcaccgcttttatcgccggcggtggtcaagaaagtggattgcgttctggcacc
gaaaatttacctggtttagcggcattaagtgaaatttttagcatgttgttaggtgaaagt
gaagctagctttaccccaataaaaactttgcacttataccgtcagcagttagtgtcagca
ttaacacaggcatttcctgagatcacttttaaccacagctttgaaaactcagtagcaacc
acccttaattttgctattcctggatttagctcgaaagaaataatggatttattcgacgct
gccaatatacgcgtaagctcaggctcagcttgtagctctaaagttacccgtagtttcgtt
ttagatgccatgggactgcccgcttggcaaagtgagtcagccattagaatgtcatttgga
cccgcgatgacccaaacagaaattgacattgcctgtagccgaatagtttcggccgctcaa
gcactggtgcagagctgtttgactcttgataaaaagaatattgatacacagaccatgaac
acgagtagcaccactaataagacggagctagacggtcttgtgcaatttaaagcaggcggc
agctgtagttggttatatgttgacaaaaaaacaagatctgcggtgtttatcgacccttta
tcggaagtcagtgaacgtctacaaacattattgacttgccgcggacttaatttagttgcc
gtcattgatacccatggtcatgcagatcataagtcttgtcgtaatggtatcgcaaagaag
tttttagccgagcaacaaactgaataccttggctggccagctggtgcgcaaacaacaacc
attcatggccaaacattccaataccttattttgggtgataagtggttaatcaaagtcgcc
acacctggtcataccgacgacagcatgagcttattactgtgcgatccagtcactgattca
gcagaaaaattacaggtacactatgccttttgtggtgatcttattttaatggatagtatt
ggtcgaagcaatttttcaaccagtagtgcgccagcaatgtattcaagcttaaagttaatg
aagtcacttatcggcaacaatagtttgatttgcccaagtcatgattatcacaacgaattt
actacctgccttgaaactgaaatgaaacgtaactcgctacttcgtcaagttatcaatagt
gaaatagatattgaagaattcactagtaaaaaaattaaaatggataaagatataatcaat
gagtctggcagtgaaatcatgtgtggcgctttaataggtgcttgccaaaaggttgtagta
cgtgaatatgacagcgccagcttaaccaaggcggtaaaaaagtcgagtgacatgaaatta
attgatatccgtgaaccacacgaatacgcactacaacacgatgaaaaattcaccagcaat
gttcctttgactcgactagtgcaatttgtaaaagagcaacaacagaataaagaacaagaa
ttcgtgttggtttgtcgtagtggcggtcgctctcaattagccgctcaagcactagctcgg
ttaggttttgaaaatgttggccatttgaaaggtggttatgctttacatcagtactaa

DBGET integrated database retrieval system