KEGG   Colwellia psychrerythraea: CPS_0840Help
Entry
CPS_0840          CDS       T00258                                 

Definition
(RefSeq) transcriptional regulator, AraC family
  KO
K04033  AraC family transcriptional regulator, ethanolamine operon transcriptional activator
Organism
cps  Colwellia psychrerythraea
Brite
KEGG Orthology (KO) [BR:cps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cps03000]
    CPS_0840
Transcription factors [BR:cps03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    CPS_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AAZ25949
UniProt: Q488C6
Position
complement(854677..855669)
Genome map
AA seq 330 aa AA seqDB search
MEIHQQIPSTTIDNNVRGISTSDVDELSQFQLNKNRRYTQLQAGQLNGAYLEANLGDVQI
FRESLNAGALIEAAPASSFLPFAAITSNADNFKYCGKQREKNTVLQATGGFWDASFQHSL
NFVVAAFDRKAFSRSIELLTGEEVPQAWFVSQACLTEPHALKTYACGLDNILTIIKSRPE
ILKKDNVQRMLSDSILRLILKVLSKTTPINVQQVSPSNRAQGVRMVIDYLHHYADQVPTI
PELCNIAKLSERNLQYGFNEYLGITPIRYLRLVRLNGVKRDLLLSHPKKDRIVDIALNWG
FIELGRFAGEYRQLFQELPSVTLNKLNQTK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcaccaacaaatccccagtaccactatcgacaacaatgttagaggtatatca
acatctgatgttgacgaactttctcaattccaactcaataaaaatcgacgatatactcaa
ctacaagcaggccaattaaatggtgcttatctagaggcaaacttaggtgatgtgcaaatt
tttcgtgaaagtcttaatgctggcgcattgattgaagctgcaccagcgagctcattttta
ccctttgcagctattacttccaatgcggacaactttaaatactgtggtaaacaaagagaa
aagaataccgtattgcaagccaccggtggtttttgggatgcgagttttcaacatagttta
aattttgtcgttgccgcttttgatagaaaggcttttagccgtagtattgagttgctcacc
ggagaagaagttccccaagcttggtttgtcagtcaagcttgcttaacggagcctcatgcc
ttgaaaacctatgcctgtggcttagataatattcttactattattaaaagtagacctgaa
atattaaaaaaagataatgttcaacgaatgctgtcggatagtattttaaggttgatactt
aaagtacttagcaaaacaacaccgattaatgtacaacaagttagcccctcaaatagggct
caaggtgttcgtatggttattgattatcttcatcattacgcagaccaagtccccacgatt
cctgaactttgtaatattgcaaaattaagcgaaagaaaccttcaatacggttttaatgaa
tacttaggtattacgcctatacgctatttacgattggtacgactcaatggtgtaaagcgt
gatttattactttctcaccccaaaaaagatcgcattgttgatatagcacttaactgggga
tttattgaattgggccgctttgcaggagaatatcgtcagctatttcaagagttaccttct
gtgacactcaataagctaaatcagacaaaataa

DBGET integrated database retrieval system