KEGG   Colwellia psychrerythraea: CPS_0847Help
Entry
CPS_0847          CDS       T00258                                 

Definition
(RefSeq) conserved hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2063
Motif
Other DBs
NCBI-ProteinID: AAZ25387
UniProt: Q488B9
Position
862583..863368
Genome map
AA seq 261 aa AA seqDB search
MTTLAELQTNFIHDCLSGSLTADNTLMANDLNTQLISAQGLMGIYQSSAIANITNSLSLS
YPVIEKLVGKDFFQVMCKPYIVKHWPTSGNMDDYGEYFSSFLAEFEQVRHLSYLEDVAQL
EWRFHQSSLANDNSYFDWARLAKVASSETLTFLLSPSVSIMCSTMPVDKVWLMNQMNAPE
NIELSLDGDGDSDTYIVLFRQGLKTEMMTVDESEFTFLQSIENGLNFETAIESAKAVDAD
IAIDHCLKKYIELGIISGFSI
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactcgcggagctgcaaactaactttatccacgattgtttatcgggctcgctc
acggctgataatactttaatggctaatgaccttaatacgcaattaatttcagcccaaggt
cttatgggaatttatcaaagtagtgccattgccaatatcactaattctttgagccttagt
tacccagtgattgaaaaattagttggtaaggatttttttcaagtcatgtgcaaaccgtac
attgttaagcactggccaacttcagggaatatggatgactatggcgaatatttttcatca
ttcttagctgaatttgagcaggtcaggcatttatcatatcttgaagatgttgctcaactg
gaatggcgttttcatcaaagttcattagcgaatgacaatagttattttgattgggctcga
ttggcaaaagttgcttcatcagagacattaacctttttattaagcccttcagtatcaata
atgtgttcgactatgccagttgataaagtttggttgatgaaccaaatgaatgcgcctgaa
aatattgagttatcccttgatggtgatggtgatagtgatacttatatcgtgctctttcga
cagggattaaaaactgaaatgatgacggttgatgaaagtgaatttacatttttacaatca
attgaaaatggtcttaattttgaaacggcaattgaaagtgctaaggctgtagatgccgac
attgcgatagaccattgcctcaaaaaatatattgaattaggtattatcagcggcttttcg
atttag

DBGET integrated database retrieval system