KEGG   Colwellia psychrerythraea: CPS_0850Help
Entry
CPS_0850          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_holin_3_6 DUF2583
Motif
Other DBs
NCBI-ProteinID: AAZ26990
UniProt: Q488B6
Position
complement(866036..866308)
Genome map
AA seq 90 aa AA seqDB search
MYSQFFIAPQLPKIENALAFQKCLVIGNYLMLLSFFVVVTSVFITFAIDDHFTISAQVSA
HIATIVFAGLLKIGYVLRCIALHGFGQRNF
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgtattcgcaatttttcatcgctcctcaactgcctaagatagagaatgcgctagctttt
caaaaatgcttagtcataggtaactatttaatgttgttatctttttttgttgtggttact
tctgtttttattactttcgctattgatgaccatttcaccatctctgcgcaagtctctgca
catattgccacaattgttttcgcgggtttactcaaaattggctatgtattgcgctgtatt
gctttacatggttttggtcaaaggaacttttaa

DBGET integrated database retrieval system