KEGG   Colwellia psychrerythraea: CPS_0865Help
Entry
CPS_0865          CDS       T00258                                 

Gene name
rpmC
Definition
(RefSeq) ribosomal protein L29
  KO
K02904  large subunit ribosomal protein L29
Organism
cps  Colwellia psychrerythraea
Pathway
cps03010  Ribosome
Module
cps_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cps00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    CPS_0865 (rpmC)
Ribosome [BR:cps03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    CPS_0865 (rpmC)
  Archaea
    CPS_0865 (rpmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L29 MRP-L47 Msg2_C TSC22
Motif
Other DBs
NCBI-ProteinID: AAZ24564
UniProt: Q488A1
Position
complement(879094..879285)
Genome map
AA seq 63 aa AA seqDB search
MKVSELKAKSIEELNAELLELLREQFNYRMQASTGQLAQTHLLRIVRRNIARVKTIITEK
AGK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttagtgaacttaaagcaaaaagcattgaagagctaaatgctgaattactagaa
cttcttcgcgagcagtttaactaccgcatgcaagcaagtactggtcaattagcacaaact
catttgctaagaatcgtacgtcgcaatatcgcacgtgttaagactatcatcactgaaaag
gcaggtaagtaa

DBGET integrated database retrieval system