KEGG   Colwellia psychrerythraea: CPS_0895Help
Entry
CPS_0895          CDS       T00258                                 

Definition
(RefSeq) ISCps3, transposase orfA
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Tnp_1 HTH_28 HTH_23 Chibby
Motif
Other DBs
NCBI-ProteinID: AAZ28163
UniProt: Q47ZW0
Position
complement(898283..898645)
Genome map
AA seq 120 aa AA seqDB search
MPKYNNPRRTWKYSNDFKVNAVQLSFVVGVTIKSVAEKLDIHPFMLSRWRKEYREGIIVV
DKRKKVAGQSKAKKVLTKEQQLERENKALKEELYILKKWQRFLAEEHQVDIDSSKNSEPT
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtacaacaatccaagacgaacttggaagtattcaaacgactttaaagtcaat
gctgttcaactgagttttgttgtcggcgtcacaatcaaatctgtcgctgaaaaactcgac
atacacccatttatgctgtcacgatggcgaaaagaatatcgtgaagggatcattgtggtg
gataaacgaaaaaaagtggcagggcaatcaaaagccaaaaaagtactgaccaaagaacag
caacttgaacgtgaaaataaagcactcaaggaggagctgtatatcctaaaaaagtggcaa
cggtttcttgcagaggaacatcaagtcgatatcgattcatcgaaaaactcagagccgaca
taa

DBGET integrated database retrieval system