KEGG   Colwellia psychrerythraea: CPS_0928Help
Entry
CPS_0928          CDS       T00258                                 

Definition
(RefSeq) conserved domain protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TMR-DISM_7TM
Motif
Other DBs
NCBI-ProteinID: AAZ24990
UniProt: Q487T8
Position
934637..934894
Genome map
AA seq 85 aa AA seqDB search
MSNMFIYHSFNYSVNRQLQHYLFSVLLGSQGLFSLSVLNFHFYLLLHQHGIINNIFSTKE
LISITVFMKISVSVVITLTTRVAWV
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatatgtttatatatcactcatttaactatagcgttaacaggcaacttcaacat
tatttatttagtgttttactcggttcacaggggctttttagtctcagtgtactcaatttt
cacttttatttgttgttacaccagcatggaatcataaataatatcttctcaacgaaagaa
ttaatttcaatcacagtatttatgaagatcagcgtgagtgtagtaattacattaacaact
cgtgtggcttgggtatag

DBGET integrated database retrieval system