KEGG   Colwellia psychrerythraea: CPS_0950Help
Entry
CPS_0950          CDS       T00258                                 

Definition
(RefSeq) conserved hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ28583
UniProt: Q487R6
Position
956889..957248
Genome map
AA seq 119 aa AA seqDB search
MRQLRWSDNSAINVFVLPSQHELHQRFAKERLQIFPYQLNRIWHKLTYSGLGVAPTIVAS
EKELIQAVTKTPGAIGYIDDDTLKKLKQNESTNRIEAPDMEAGQQASGKGVVNVIKIKD
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaattgcgttggagtgataatagtgcaattaatgtctttgtattaccgagtcag
cacgaactccatcaacgatttgctaaagaacggttacaaatatttccttatcaacttaat
cggatttggcataagttaacttactcggggttaggtgtcgcaccaacaatagtggcttct
gaaaaagagcttattcaagcggttactaaaacacccggtgcaattggttatatagatgac
gatacgttaaaaaagttaaagcaaaatgaaagtactaacaggatagaagcccctgatatg
gaagcaggtcagcaggctagtggtaaaggagtagtaaatgttatcaaaattaaagactaa

DBGET integrated database retrieval system