KEGG   Colwellia psychrerythraea: CPS_1431Help
Entry
CPS_1431          CDS       T00258                                 

Definition
(RefSeq) alcohol dehydrogenase, iron-containing
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AAZ26879
UniProt: Q485U1
Position
1468346..1469506
Genome map
AA seq 386 aa AA seqDB search
MSTQVILPRIMQVGENASQEIANVLVSIGCTRPLIITDKMMVGLGYARRIQVSLGAHHIP
AHIFDDTVPEPTVESIQAGVDKAREGNYDCIIALGGGSPIDSAKAIAILAKHGGVMQDYR
FPRMVIEQGLPVIAVPTTAGTGSEVTKFTIITDEKNDEKMLCVGIGFMPVAALVDYKLTI
SLPPRTTADTGIDALTHAIEAYVSKKANPYSDSQAIAAIKLIGPNLRKVYHSGEDQDARE
AMMLGSTLAGIAFSNASVALVHGMSRPIGAFFHVPHGLSNAMLLPSVTAFSIPAAPARYA
DCARAMGIAAEQDSNEVANQKLLIELRSLNEELAVPTPQEFGIKRDEFFEVCQTMAEQAL
ASGSPSNNPIEPSINEIISIYQGLWD
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctactcaagttattctgccacgtattatgcaggtgggtgaaaacgcaagtcaggaa
atagccaacgtattagttagtattggctgtacccgaccattgattattactgacaagatg
atggtgggattgggctacgctcgtcgaattcaagtcagtttaggcgcacatcatattccc
gcccatatcttcgacgataccgtgccagagcctacagttgaatctattcaagcgggtgtt
gataaggcacgagagggtaattacgattgtattatcgcccttggtggtggaagtccaatc
gatagtgctaaagccattgctatcttggccaaacatggtggtgtgatgcaagattaccgt
tttcctcgtatggttatagagcaaggcttacctgtcattgccgtacctactacggcgggg
actggatctgaagtcactaaatttaccatcattaccgatgaaaaaaacgacgaaaagatg
ctgtgtgtcggcattggcttcatgcccgttgcagcattggtggattataaattaaccatt
agtttgcctcctaggaccactgccgatactggaatcgatgccttgacccatgcaattgaa
gcgtatgtgagtaaaaaagcaaacccatatagtgatagtcaggcaattgctgcgattaaa
ttgattggacctaatttgagaaaggtctatcacagcggcgaagatcaagatgctcgtgaa
gctatgatgctgggttcgaccttagctggtattgcattctctaacgcatcggtggcatta
gtgcatggtatgagtcgacctattggtgccttttttcatgtacctcatggtctctcaaat
gcgatgttattgcccagtgttaccgctttttctattcctgcggcaccagcgcgttatgcg
gattgtgctcgggcgatgggtattgcagctgagcaagatagcaatgaagttgccaatcag
aaattattaatcgagcttcgttcactaaatgaagaattagcagtaccaacgccacaggaa
tttggtattaagcgcgatgagttttttgaggtgtgtcaaacaatggctgaacaagcatta
gcttcaggctcaccgagtaataaccctattgagccatctatcaacgaaattatcagtatt
taccaggggctatgggattaa

DBGET integrated database retrieval system