KEGG   Colwellia psychrerythraea: CPS_1605Help
Entry
CPS_1605          CDS       T00258                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00071  Fatty acid degradation
cps00072  Synthesis and degradation of ketone bodies
cps00280  Valine, leucine and isoleucine degradation
cps00310  Lysine degradation
cps00362  Benzoate degradation
cps00380  Tryptophan metabolism
cps00620  Pyruvate metabolism
cps00630  Glyoxylate and dicarboxylate metabolism
cps00640  Propanoate metabolism
cps00650  Butanoate metabolism
cps00900  Terpenoid backbone biosynthesis
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
cps01212  Fatty acid metabolism
cps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPS_1605
   00630 Glyoxylate and dicarboxylate metabolism
    CPS_1605
   00640 Propanoate metabolism
    CPS_1605
   00650 Butanoate metabolism
    CPS_1605
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CPS_1605
   00072 Synthesis and degradation of ketone bodies
    CPS_1605
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPS_1605
   00310 Lysine degradation
    CPS_1605
   00380 Tryptophan metabolism
    CPS_1605
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPS_1605
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CPS_1605
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPS_1605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cps04147]
    CPS_1605
Enzymes [BR:cps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CPS_1605
Exosome [BR:cps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPS_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAZ26350
UniProt: Q485B8
Position
1652165..1653349
Genome map
AA seq 394 aa AA seqDB search
MSLSDPIVIVSAVRTPMGGFGGCLSPVTTPDLGATAIKAAITRANLANDQVDELIMGCVL
PAGLKQAPARQAAIAAELSLSTVCTTINKVCGSGMKAAMQAHDSLLAGSIDVAVAGGMES
MSNAPYILPKVRTGLRMGHGQVIDHMMQDGLENAYDGISMGCFAQDTADESSFTREAMDD
FAIRSLSRANQAIDSGAFKNEIAAVTVVNRRKETIIDTDEQPGNARPDKIPSLRAAFKKD
GTITAANSSSISDGAAALVMMKLSEAEKRGLTPLCKIVAHATHAQAPAEFTAAPVGAMNK
LLDKAGWTARDVDLFEINEAFAMVTMLAVKEMDLDINKVNVNGGACALGHPLGASGARIM
VTLIHALKNKGLSKGVASLCIGGGEATAIALEML
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatcagatcctattgttattgtttccgctgtaagaacgcctatgggtggtttt
ggtggttgtttgtcgccggtaactacgccagatttaggtgctaccgcaataaaagccgct
attactcgagcaaatttagccaatgatcaagttgatgaactcattatgggctgtgtctta
cctgcaggtttaaagcaagcgccagcaagacaagcagcaattgctgctgaattatcttta
tctactgtgtgtaccacaatcaataaagtatgtggctcaggaatgaaagcggctatgcag
gcgcatgactcattacttgcaggatctatcgatgttgccgttgctggtggtatggaaagc
atgagtaatgcgccatatattttgccgaaagtaagaacaggtttacgcatgggccatggt
caagttatagatcatatgatgcaagacggtttagaaaatgcctatgacggaatttctatg
gggtgttttgcccaagatactgccgatgaatctagctttactcgtgaagcgatggatgat
ttcgcgattcgttcattgagtcgtgcaaaccaagcgattgattcgggcgcttttaaaaat
gaaattgcagccgttacggtagttaatcgacgtaaagaaacgattattgataccgatgaa
cagccaggaaatgctcgtccagataagatcccatcattacgcgcagcatttaaaaaagac
ggcaccatcaccgcagctaattcaagttcaatttcagatggcgcagcagcgcttgtgatg
atgaaattatcagaagctgaaaaacgtggtttaacaccactttgtaaaattgtagctcat
gctacacatgcacaagcaccggcagaatttaccgcagcaccagtaggcgctatgaataaa
ttactagataaagcaggttggactgcaagagatgttgatttattcgaaatcaatgaagca
tttgctatggtcactatgcttgctgttaaagaaatggatttagatatcaataaagttaat
gttaatggtggtgcttgtgccttaggtcacccattaggcgcaagtggagcgcgtattatg
gtaacccttattcatgcattgaagaataaaggtttgtcaaaaggtgttgcttctctttgt
attggtggcggtgaagcgacagcaatcgcattagaaatgttgtaa

DBGET integrated database retrieval system