KEGG   Colwellia psychrerythraea: CPS_1971Help
Entry
CPS_1971          CDS       T00258                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00240  Pyrimidine metabolism
cps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CPS_1971 (tdk)
Enzymes [BR:cps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CPS_1971 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 DUF2075
Motif
Other DBs
NCBI-ProteinID: AAZ25756
UniProt: Q483R5
Position
complement(2040196..2040774)
Genome map
AA seq 192 aa AA seqDB search
MAQLYFYYSSMNAGKSTHLLQSSYNYQERGLVTAIYTAKIDDRFAKGKVASRLGIDADAF
LFDEKINLFKDVDQKHQAEKIDCVLIDEAQFLSTEQVKQLTDIVDLLHIPVLAYGIRTDF
LGQTFSGSAALLAWADKLVELKTICHCGRKANFVIRQDANGKAVQNGEQVEVGGNERYEP
LCRAHFKQLVWL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactttatttttattactcatcgatgaatgcgggaaaatcaactcacctttta
caatcatcttataactatcaagaacgtggcttagtcaccgctatttatactgcgaaaatt
gatgatagatttgcaaaaggcaaggttgcttcacgattaggtattgatgcagacgctttt
ttattcgacgaaaagatcaatctatttaaagacgttgaccagaaacatcaagctgaaaaa
attgattgtgtactaatagacgaagcacagtttttgtcaactgaacaagttaaacagctt
actgatattgtcgacctattgcatattcctgtattggcttatggcatacgcactgacttt
ttaggacaaaccttctcaggtagtgccgctttgctcgcttgggctgacaaattggttgaa
ttaaaaacgatatgtcactgtgggcgaaaagctaactttgtcatcagacaagatgctaac
ggtaaagcggtacaaaatggtgagcaagtagaggttggtggcaatgaacgttatgagccc
ctttgtcgtgctcattttaagcaactcgtctggctataa

DBGET integrated database retrieval system