KEGG   Colwellia psychrerythraea: CPS_2626Help
Entry
CPS_2626          CDS       T00258                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00071  Fatty acid degradation
cps00072  Synthesis and degradation of ketone bodies
cps00280  Valine, leucine and isoleucine degradation
cps00310  Lysine degradation
cps00362  Benzoate degradation
cps00380  Tryptophan metabolism
cps00620  Pyruvate metabolism
cps00630  Glyoxylate and dicarboxylate metabolism
cps00640  Propanoate metabolism
cps00650  Butanoate metabolism
cps00900  Terpenoid backbone biosynthesis
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
cps01130  Biosynthesis of antibiotics
cps01200  Carbon metabolism
cps01212  Fatty acid metabolism
cps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPS_2626
   00630 Glyoxylate and dicarboxylate metabolism
    CPS_2626
   00640 Propanoate metabolism
    CPS_2626
   00650 Butanoate metabolism
    CPS_2626
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CPS_2626
   00072 Synthesis and degradation of ketone bodies
    CPS_2626
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CPS_2626
   00310 Lysine degradation
    CPS_2626
   00380 Tryptophan metabolism
    CPS_2626
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CPS_2626
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CPS_2626
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CPS_2626
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cps04147]
    CPS_2626
Enzymes [BR:cps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CPS_2626
Exosome [BR:cps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPS_2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAZ26727
UniProt: Q481C9
Position
2729887..2731095
Genome map
AA seq 402 aa AA seqDB search
MNKVYLVSAKRTAIGSFGGALKSVPAANLAAAAVKGALAEANVNPDQLDELIMGNVISAG
QGMGPGRQAAIAAGAPETIPAYTVNMICGSGMKVVMDAASRIKAGDADLVMACGGENMSR
FPYIVTSDIRFGSKMGNLELSDSLITDGLTDVFNNYHMGITAENIAEQVGVSREEQDAFA
LESQRRAVSAIEAGKFSDEIVPVEVMVRRKTAVVDTDEYPRQDASQESLAKMRAAFKKDG
TVTAGNSSGVNDGGAAILVASQGAVDQHQLKPVAELVSYAQVGVDPTVMGLGPVPAIKEA
LAKANLKFSDIELLELNEAFAAQALGVMKQLCVEHDEDLDNLKQRTNVNGGAIALGHPLG
ASGNRIIVTLLHEMRKRGNKLGLASLCIGGGMGTAVIVRLLD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtatatttagtatcagcaaagcgtacagcaattggaagttttggcggggca
ttaaaatcggtgcctgccgctaatctggccgcagcggccgttaaaggcgccttggctgag
gccaatgtcaatccggatcaattagatgaattgatcatgggtaacgtcatatctgccggg
cagggcatggggcctggacgtcaagccgccattgctgcaggtgctcccgagacaatacca
gcttatacagttaacatgatctgtggcagtggcatgaaagttgtcatggatgcagcgtcg
cgcatcaaggctggtgatgccgaccttgtgatggcctgtggtggtgaaaatatgtcacgg
ttcccttatatcgtgacgtcagatattcgttttggcagcaaaatgggcaatctggagtta
tctgattcgctgatcaccgatggcctgaccgatgtctttaataactaccacatgggcatt
accgccgaaaatattgcggaacaagtcggtgttagtcgtgaagagcaagatgcatttgcc
ttagaaagccagcgccgtgccgttagcgccatagaagccggtaagtttagcgatgaaatc
gtaccagttgaagtaatggtgcgtcgtaagactgctgtcgtggataccgatgaatatccg
cgccaggatgcctcgcaggaatctttagctaagatgcgtgccgcctttaaaaaagatggc
acagtgaccgcaggaaattcctcaggtgttaatgatggcggggctgcaattttagttgcc
tcgcagggcgctgttgatcagcatcagcttaagcctgtcgccgagttggtgagttatgct
caagtgggcgtcgatccaaccgtgatgggactgggtcctgtgccggcaattaaagaggca
ctagctaaagccaatcttaaattttctgatatcgaattgctggaactcaatgaagccttt
gctgctcaggcattaggtgtgatgaagcagttatgtgttgagcacgatgaagatttggat
aacctcaaacaacgcactaatgttaatggtggtgctattgcgttaggacatccattaggt
gcctctggtaaccggatcatagtcactttgctccatgaaatgagaaaacggggtaacaag
ttaggactggcatcactttgcatcggcggtggtatgggtactgctgtgattgtaagactg
cttgactaa

DBGET integrated database retrieval system