KEGG   Colwellia psychrerythraea: CPS_3655Help
Entry
CPS_3655          CDS       T00258                                 

Gene name
cobQ
Definition
(RefSeq) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00860  Porphyrin and chlorophyll metabolism
cps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPS_3655 (cobQ)
Enzymes [BR:cps01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CPS_3655 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB
Motif
Other DBs
NCBI-ProteinID: AAZ28125
UniProt: Q47XZ7
Position
complement(3798983..3800593)
Genome map
AA seq 536 aa AA seqDB search
MNTKQSNSHSTPSTFEGAQIRQGKASQCKTLMVQGTTSDAGKTTLVAGLCRVFADLQVKV
APFKPQNMALNSAVTPCGGEIGRAQALQAKAARLALDVDFNPILLKPNSDTGAQVIVHGK
ALMHRSSSNMEASEYQDYKKVAMQAVLSSHQRLTQQYDLVVVEGAGSPAEINLRKGDIAN
MGFAEAVDCPVLIIADIDKGGVFAQLVGTLMLLSQSEQDRVVGFVINRFRGDIKLLESGL
TWLEERTNKPVLGVLPYLHGLDISSEDALVTQQALVEGTSTSSKVRIVVLVYPHMSNHTD
FDALRHHEDIDCQFLFAKGSKDEINPEKIAIPACDLIILPGSKNVRGDLDFLRQRGWDDD
IAKHLRYQGKVIGVCGGYQMLGALIADPEGLEGQPGVSEGLSYFAMNTVLESKKTLINVS
GILELTDKKADISGYEIHAGVSTLNNSGAKLSHLITIAGEGQGLISDDGQIAGCYLHGLF
DQPEALQLFMGWLGYDVKKAPSIEILEEQAIERVSKACQVHLDMVKIKQIVTEWYK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaacactaagcaaagtaacagccattctacaccgagtacttttgagggagctcaaatt
aggcaaggcaaagcgagtcaatgtaaaaccttgatggtacaaggaacgacatctgatgcg
ggaaaaacaactctcgtggcagggctatgccgtgtgtttgctgatttacaggttaaggtc
gcaccctttaaaccacagaatatggcgcttaatagtgccgtgacaccatgtggcggtgaa
attggacgagcacaagcgttgcaagctaaagcggcgcgtttagcgttagatgtagacttc
aaccccatattgctcaaacctaatagtgatactggcgcgcaagttattgtgcacggtaaa
gcacttatgcatagatcatcgtctaatatggaggctagtgagtaccaagattataaaaaa
gtggctatgcaagcggtattgagttcgcaccaacgcttaacacagcagtacgatttagtt
gttgttgagggggcaggaagtccagcagaaataaacttacgcaagggtgatattgctaat
atgggctttgccgaagccgttgattgtcctgtattgattattgctgatattgataagggg
ggcgtttttgctcagctcgttggtaccttgatgttgctgtcacaatcagagcaagacaga
gtggttggttttgtgattaatcgctttcgcggggacattaaattacttgaatctgggctg
acatggttagaagaaaggaccaataaacctgtgctgggagttttaccctatttacatggc
ttagatatatcttctgaagatgccttagtcacacaacaggcgctagttgagggaacatcg
acttcatcaaaagtgcgtattgtagttttagtttatccacatatgagtaatcataccgac
tttgatgctctgcgccatcatgaagatattgattgccagttcctttttgctaaggggtcg
aaagatgagattaatcccgaaaaaatagctatcccagcgtgtgatcttattattttaccc
ggtagtaaaaatgtccgtggcgaccttgattttttaaggcaacgaggctgggatgacgat
attgccaaacatctacgctatcaaggcaaggtaattggtgtttgtggtggttatcaaatg
ttaggggcgttgattgcagaccccgaaggattggaaggacaacctggcgtaagcgaaggg
ttaagttattttgcgatgaataccgttttagagtcgaaaaaaacgttaattaatgtttca
ggtattttggaattaacagacaaaaaggctgatattagtggttatgagattcatgctggt
gtgagcacactcaataactctggcgcgaaactgtctcatttaattactatcgcaggagaa
gggcaagggttaataagcgatgatggtcaaatcgctggttgctatttacatggactattt
gatcaacctgaagcgttacaactctttatgggttggcttggttatgatgtaaaaaaagcg
cccagcatagaaatacttgaagagcaggccattgagcgggtaagtaaagcctgtcaagta
cacttagatatggtgaaaataaaacaaatagttacagaatggtacaaataa

DBGET integrated database retrieval system