KEGG   Colwellia psychrerythraea: CPS_3762Help
Entry
CPS_3762          CDS       T00258                                 

Gene name
maiA
Definition
(RefSeq) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00350  Tyrosine metabolism
cps00643  Styrene degradation
cps01100  Metabolic pathways
cps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CPS_3762 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    CPS_3762 (maiA)
Enzymes [BR:cps01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     CPS_3762 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: AAZ24342
UniProt: Q47XP1
Position
complement(3927032..3927670)
Genome map
AA seq 212 aa AA seqDB search
MKLYGYWRSTAAYRVRIALHMKGIAFESISVHLVKNGGEQHHNTYSELNPNHLVPTLVDG
DFSLNQSLAIIDYLDQTNSENYLYPKEAKSRAKVHALALDIACEIHPLNNLRVQQYLTNS
LNITEEAKQLWVEYWMNVGFIAIEKQLASSAGQFCFANTVSVADICLVAQVYNAHRFNVD
MSAYPIINKIVKNCNELPAFINALPENQSDAK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttatggctattggcgctcaacagcagcgtatcgtgtccgaattgcactgcac
atgaaaggtattgcctttgagtcaatctcagtacatcttgttaaaaatggcggagaacag
caccataatacctacagtgagctcaacccaaatcacttagtgccaaccttagttgatggt
gatttttcattaaaccaatctttggctattattgattacttagatcaaaccaacagcgaa
aactatttatatcccaaagaggcaaaaagtagagcgaaagtacatgctttagcgttagat
atagcttgcgagattcaccctctcaataacttacgggtgcagcaatatttaactaactca
ttaaatataacagaagaagcgaagcagttatgggttgaatactggatgaatgttggcttt
atcgcaatagaaaagcaattagcgagcagtgcagggcagttttgttttgccaataccgtg
agtgttgctgatatttgtttagtggcgcaagtttataatgcgcatcgatttaacgttgat
atgagcgcttacccgataattaataaaatagtcaaaaactgtaatgaattgcctgctttt
attaatgctttaccagagaaccagtcagacgcaaagtaa

DBGET integrated database retrieval system