KEGG   Colwellia psychrerythraea: CPS_4377Help
Entry
CPS_4377          CDS       T00258                                 

Definition
(RefSeq) hypothetical protein
Organism
cps  Colwellia psychrerythraea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_MalT TPR_1 TPR_12 TPR_2 TPR_10 DUF3336 ETRAMP
Motif
Other DBs
NCBI-ProteinID: AAZ24163
UniProt: Q47VZ6
Position
complement(4610552..4612495)
Genome map
AA seq 647 aa AA seqDB search
MFYFSITNGIDMTIKRLFLFIVFTFKVQLLSFILVSTAHAQAASEQAVLSNQVQQLLKVD
NEMIDADIVKSLSEKIINNRHDYSNDILAKVYLLSAKVASNQGNMNNVFEFTKRGLAANS
LDKKIKLALLFKLADVYVARKEYKQLLEVTEEAVRNSEFSRSVKCRLLSLSYRSVAFAML
GKHQQALADLQQVELGISSSELTEHIQLLTILALAYHHLGDYQTSLTMQLKILKLRFEMN
QKRNIAQTYLYLGYAYFYLQRFDDAYNVFWESKKSAEGNNAPINVAHADKWLGIVLMRQK
QFHAALEPLQQAIEVFHQHNMLSERIETSVALVSAKLGVEQITEGYALLNEVVRLLNGKN
IASEYTGFYRMVAEMHFSQENYRLAYDWRKKYSQILLDNLNDKRKSFSIMQGLSHLAVGK
TPKIEPVEESKRLAVKLAESSELSSSFIGKYEKQRIIIISLSVLVALLILTLVGLFLRSR
AQKINRAYQELEKPSHSMASPMQTKFTYQLAFKKARKFRYPFHVGYLVVENWQELVFHFN
SKTISEVTKGLASVINEHIAEFDYVGLLNEGEYLLLFEHQSSQEVNEKLDKLVQAVNTRA
FANLGDFSVTMKYSLNMAGFKDIDPYLFLARIDESVNIAQVNPSKAP
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgttttatttttcaattactaacggtatagatatgacgataaaacgattgtttctgttt
atagtatttacttttaaagtgcagttactttcttttattttagtcagtactgctcacgca
caagccgcgtctgaacaagccgtattaagtaatcaagttcagcaattattgaaagtagat
aatgaaatgattgatgctgatatagtgaagtcactgtcggaaaaaatcattaataatcga
cacgattactcaaatgatatcctcgcaaaagtctatttactttctgcaaaggttgctagt
aatcaaggaaatatgaacaacgtttttgagtttactaaaagaggcttagcagcaaatagt
ttagataaaaaaattaaattggcgctgttattcaaattagcggatgtatatgtagccaga
aaagaatacaagcagttgttagaagtgactgaagaagcagtaaggaatagtgaatttagt
cgtagtgttaagtgtcgactattgtcgctaagttatcgtagcgtcgcgtttgcaatgcta
ggaaaacatcagcaggctttggccgacctacaacaagtcgagcttggtatcagtagtagt
gaactaacagagcatattcaattactgactattttagccttggcttatcaccatttagga
gactatcaaacatcactaaccatgcagttaaaaatattaaaattaagatttgaaatgaat
caaaaaagaaatattgctcaaacctatttatatctagggtatgcctatttttatctacaa
cgctttgatgatgcatataatgttttttgggaatctaagaaatctgctgagggtaataat
gcacctattaatgttgctcatgctgataagtggttaggtatcgttttaatgagacaaaaa
caatttcatgcagcacttgaacctttacagcaagcaatagaagtttttcatcaacataat
atgctttctgaacgtatagaaacgtcggttgctctggttagtgctaaattaggtgttgaa
caaataactgaaggttatgccttactaaatgaagtggtacgccttcttaacggtaagaat
attgcgtcagaatatacaggcttttatcgaatggttgcagaaatgcacttttctcaagaa
aactaccgacttgcttatgactggcgtaaaaaatatagtcaaatattactcgacaacctt
aatgataaaagaaaatcgtttagtataatgcagggtttatctcatttagcggttgggaaa
acacccaaaattgagcctgttgaagagtcaaaaagacttgctgttaaattagctgaaagc
agtgagctatcaagtagctttatagggaagtatgaaaaacaacgtatcattattataagt
ttatcggtattagttgctttattaatactcaccttggtaggtttgttcttgaggtcaaga
gcgcaaaaaataaatagggcatatcaagagcttgaaaagccaagtcatagtatggcgagt
ccgatgcaaacaaaattcacttaccaattggcctttaaaaaggcaaggaagtttcgatac
cctttccatgtaggttacctggttgttgagaattggcaggagcttgtttttcattttaat
agtaaaacgattagtgaagtgactaaaggtttggccagtgtaattaatgaacatatagca
gagtttgactatgtgggattgttaaatgaaggtgagtatttactgctttttgagcaccaa
agtagccaagaagttaatgaaaagttagacaagctagtgcaagctgtaaatacaagagct
tttgcaaatttaggtgatttttcagtgacaatgaaatattcgttaaatatggcaggtttt
aaagatattgatccgtatctatttttggcacgcattgatgagtctgttaatattgcgcaa
gttaatccgtctaaggcaccttaa

DBGET integrated database retrieval system