KEGG   Colwellia psychrerythraea: CPS_4629Help
Entry
CPS_4629          CDS       T00258                                 

Gene name
hemL
Definition
(RefSeq) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00860  Porphyrin and chlorophyll metabolism
cps01100  Metabolic pathways
cps01110  Biosynthesis of secondary metabolites
cps01120  Microbial metabolism in diverse environments
Module
cps_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPS_4629 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cps01007]
    CPS_4629 (hemL)
Enzymes [BR:cps01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     CPS_4629 (hemL)
Amino acid related enzymes [BR:cps01007]
 Aminotransferase (transaminase)
  Class III
   CPS_4629 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AAZ27946
UniProt: Q47V96
Position
4891539..4892822
Genome map
AA seq 427 aa AA seqDB search
MNKSEQLFEQAQKIIPGGVNSPVRAFNGVGGTPCFIKRAQGAYIYDADDKAYIDYVGSWG
PMILGHNHPAILEAVITTAKNGLSFGAPTEIEITMAEKVRELVPSMESLRMVSSGTEATM
SAIRLARGYTGRDKILKFEGCYHGHADALLVKAGSGALTLGVPNSPGIPEDFAKHTLTVS
YNNIDEVKEIFAKYADEIACIIVEPVAGNMNCIPPVEGFLEGLRDVCDQYSSVLIFDEVM
TGFRVALGGAQAHYNIKPDLTTLGKVIGGGMPVGAFGGKQEIMDYIAPVGPVYQAGTLSG
NPIAMAAGLASLTELAQGNKHQQLSSATEKLAMGLKAAAERNGVSLSVNYVGAMFGFFFT
EDKNPITTYEQATQCDGEMFKRFFHLMLDEGVYLAPSSYETGFLSTSHTDDIIEKTLVAA
DKCFAQL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcagaacagttatttgaacaagctcaaaagattatccctggtggcgttaac
tctccagtacgtgctttcaatggtgttggtggtactccgtgttttataaaacgtgctcaa
ggcgcttatatttatgacgctgatgataaagcttacatcgactatgttggctcttgggga
cctatgattttaggtcataaccatccagcaatacttgaagctgttattactaccgctaaa
aatggtttaagtttcggtgctccgactgaaattgaaattaccatggctgagaaggtacgt
gagttagtaccttcaatggaatctttacgcatggttagctctggtacagaagctacgatg
agcgctatccgtttagcacgtggttatactggccgcgataagatattaaagtttgaaggt
tgttatcacggtcatgccgacgctttgttagtaaaagcgggttctggtgcattaacattg
ggcgtacctaattcaccgggtattcctgaagattttgctaaacatacccttaccgttagc
tacaataatatcgacgaagtgaaagaaattttcgcaaaatatgccgatgagatagcgtgt
attatcgttgaacctgttgcaggtaatatgaactgtatccctcctgttgaaggattcctt
gaaggtttacgcgacgtatgtgaccaatacagcagcgtattaatttttgatgaagtaatg
actggctttcgtgttgcactaggtggcgctcaagctcactataatattaaacctgactta
actactttaggtaaagtcattggtggtggtatgcctgttggcgcattcggtggcaaacaa
gagatcatggattatatcgctcctgttggtcctgtttatcaagcaggaactttatcaggt
aacccaattgctatggccgcgggtttagcttcattgactgaattagctcaaggaaataaa
caccaacaactttcttctgctacagaaaagttagccatgggcttaaaagccgcagctgaa
cgtaatggcgttagtttaagcgttaactacgttggcgccatgtttggatttttctttacg
gaagataaaaaccctattactacctatgagcaagcgacccaatgtgatggagaaatgttc
aagcgcttcttccacttaatgcttgatgaaggcgtatatttagcaccatcatcttatgaa
actggctttttatcaacatcacataccgatgacattattgaaaaaaccttagttgctgcc
gataagtgtttcgctcagttgtaa

DBGET integrated database retrieval system