KEGG   Colwellia psychrerythraea: CPS_4660Help
Entry
CPS_4660          CDS       T00258                                 

Definition
(RefSeq) FAD-dependent oxidoreductase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
cps  Colwellia psychrerythraea
Pathway
cps00310  Lysine degradation
cps01100  Metabolic pathways
cps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CPS_4660
Enzymes [BR:cps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     CPS_4660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 Mqo Pyr_redox_2 HI0933_like Pyr_redox_3 FAD_binding_2 Thi4 Amino_oxidase TrkA_N K_oxygenase GMC_oxred_N SpoU_sub_bind CheZ
Motif
Other DBs
NCBI-ProteinID: AAZ24122
UniProt: Q47V68
Position
complement(4923540..4924739)
Genome map
AA seq 399 aa AA seqDB search
MIYDYIIIGGGIVGVSTAWQLQQRYPDKKVLLLEKESEFATHQTGHNSGVIHAGVYYEPG
SLKAKFCRAGVDATINFCQQHNIPFNQCGKLLVATNELEVKRMEALYQRCQKNNIEVELL
DKQQLKIEEPNITGLGAILVRSTGIVDYQLITIKMAQEFQSLGGECRLNTKVTQLKETAE
EIRVSSNQGEFYSRYLITCSGLMADRVVKMLDIKVDFQIVPFRGEYYQLPANKNAIVNHL
IYPIPDPTLPFLGVHLTRMIDGSVTVGPNAVLGFKREGYGKININLRDIKEMVMFAGFWK
VLGKNLSSGITEFKNSLFKKGYLTLVRKYCPSIELSDLKSYPAGIRAQAVMNDGSLVHDF
LFANSERTINVCNAPSPAATSAIPIGGYIVDKVSEHFCS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatctatgactacataatcattggcggtggtattgttggtgtatcgactgcttggcag
ctacaacaacgctatccagataaaaaagtattattattggaaaaagaaagtgaatttgcc
actcatcaaactggacataatagcggtgttattcatgctggcgtatattatgagcctggc
agtttaaaggctaagttttgtcgagcaggggtagatgccactatcaatttttgtcagcaa
cataatattccttttaatcaatgcggtaagttgttggttgccaccaatgaattagaagta
aagcgcatggaggcgctttatcaacgctgccaaaagaataatattgaagtggagttatta
gataagcagcaacttaaaattgaggagcctaatattactgggcttggcgctattttggtt
agatcgacaggcattgtcgattaccaactcattaccattaaaatggcgcaggaatttcag
tctttgggcggtgaatgcagactaaataccaaagtaactcagttaaaggaaacggcagaa
gagattcgcgtgagttcaaaccaaggtgaattttatagtcgttacttaatcacctgttca
ggtttaatggctgatcgtgtggttaaaatgttagatattaaagtcgattttcaaattgta
ccgtttcgtggtgagtactatcagttgccagcgaataaaaacgccattgttaatcactta
atatatccgattcctgatccaacattaccttttttaggtgtgcatttaactcggatgatt
gatggcagcgtcactgttggtcccaatgcggtattgggttttaaacgagaaggttatggc
aaaattaatattaacttacgtgatattaaagaaatggtgatgtttgctggcttctggaaa
gtactggggaaaaacttgagttctggcattactgagtttaaaaattcactctttaaaaag
ggttatttaaccttggtgcgaaaatattgcccctcaatagagctatcagatctcaaatca
tatcctgcaggtattcgtgcgcaagcagtaatgaatgatggcagtttagtgcatgatttc
ttgtttgctaatagcgagcgaacaattaatgtctgtaatgcgccatcgccagcagcgact
tcggccatccccattggtggttatattgttgataaagtcagtgaacatttttgttcataa

DBGET integrated database retrieval system