KEGG   Chlamydia psittaci Mat116: AO9_04600Help
Entry
AO9_04600         CDS       T02450                                 

Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
cpsa  Chlamydia psittaci Mat116
Pathway
cpsa00740  Riboflavin metabolism
cpsa00790  Folate biosynthesis
cpsa01100  Metabolic pathways
cpsa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AO9_04600
   00790 Folate biosynthesis
    AO9_04600
Enzymes [BR:cpsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     AO9_04600
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     AO9_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AGE75471
Position
complement(1025309..1026571)
Genome map
AA seq 420 aa AA seqDB search
MIKFNNDARASCFVPVEKAIADIAEGKFVIVVDETSRENEGDLIIAGEKMTVEKMTFLLK
YTTGIICAALDSERVKQLDLPPMVKDNRCRYRTAFTVSVDAAKGVTTGVSAADRTRVVEL
LSDPNSVPEDFVRPGHFFPLMATPGGVLKRAGHTEAALDLMRLANMQACGILSELVNEDH
TMMRLPQIVEFAMKHKISVISTSDLVAYRMLSERLVVPISSARLPTEYGDFNIHVYESVL
DGIQHIALVKGDVQGKENVLVRVHSECLTGDIMGSIRCDCGHQLRSAMEYIGLEGEGVIV
YLRGQEGRGIGLGHKVRAYALQDRGYDTVDANLEIGFPIDSREYGIGAQILVDLGLTKIK
LITHNPHKYYGLQGYGLEIVDRIALPINISEENECYLRTKKERMGHWIDFPSYKEEVNTR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaattcaataatgatgctcgtgcctcttgttttgtccctgtagaaaaagctatt
gcagatatcgctgagggtaaatttgttattgttgttgatgagacttcaagggagaatgag
ggagatcttatcatagcaggcgagaaaatgaccgttgaaaaaatgacttttctccttaaa
tatacgacgggaattatctgtgctgctttagattctgagagagtaaaacaattagacctc
ccccctatggttaaagataaccgttgtcgctaccgtacggcatttacagtttcggtagat
gctgctaaaggcgtaactacaggcgtgtctgcagcagatagaacaagagtagttgaactg
ctatctgaccctaatagtgttcctgaggattttgttcgtccggggcatttctttccttta
atggctacgccgggaggcgtattaaaacgagccggtcatacagaagctgctttagatctc
atgcgtttagccaatatgcaggcttgtgggatcctttcggagcttgtcaatgaagaccac
acgatgatgcgtcttccgcaaattgtagaatttgctatgaagcataaaatctcggtcata
tctacgtctgatttggtagcctaccgaatgttatccgaaaggctcgtggttcctatttct
tcagctcgtcttcctacagaatatggggattttaatattcatgtttacgagtccgtgctt
gatggcatccaacatattgctttggtgaaaggtgatgtgcaagggaaggagaatgtactt
gtgcgagtacattctgaatgccttactggtgatatcatggggtccatacgttgtgattgt
ggacaccaattgcgctctgctatggaatatattggattagagggtgaaggtgttattgtt
tatctacgcggacaagagggacgtggtattggattaggtcataaagttcgagcctacgct
ttacaagatcgtgggtatgatactgtcgatgctaacttagaaattggcttccctatagat
tctagagaatatggaatcggggctcagattttagttgatctaggattgacaaagatcaaa
ttgattacccataatccccacaaatattacggccttcagggatatgggttagaaattgtt
gatagaatagctcttcccatcaatatctctgaagaaaatgaatgttacctccgcacaaaa
aaagagcgtatgggacattggatagactttccttcttataaagaagaagtgaacacaaga
taa

DBGET integrated database retrieval system