KEGG   Chlamydia psittaci 84/55: B595_0010Help
Entry
B595_0010         CDS       T02308                                 

Gene name
recB
Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
cpsb  Chlamydia psittaci 84/55
Pathway
cpsb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpsb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    B595_0010 (recB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cpsb03400]
    B595_0010 (recB)
Enzymes [BR:cpsb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B595_0010 (recB)
DNA repair and recombination proteins [BR:cpsb03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     B595_0010 (recB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 Viral_helicase1 AAA_30 AAA_22 AAA_11 AAA_12 ResIII PDDEXK_1
Motif
Other DBs
NCBI-ProteinID: AFS18994
Position
complement(7915..11052)
Genome map
AA seq 1045 aa AA seqDB search
MKPFDIFHPETSIQGKYFLEASAGTGKTFTIEQIVLRALLEGSVSHVENILVVTFTNAAT
NELKLRIQENLKQAASQLKSAITNPEHPLPPYLSPPCDVKQLYMQVRNALASIDRMAIFT
IHGFCNYVLQQHFPEMQISQKNSALTHSQTVLHHIRKYLSQDLWENVLFPEQFYLLAARY
NSNSKHTSFLTDKLLSSYTVQTFDHLPSKSTTTSLLNTWHSSIRSKIKDIPKENFLEQAL
KYTESFKKQPFSITEDLLSFVDHLYASETSVRLLSFSKIAETFHPKNRLARYQPCHAFSY
IEETSWFQDTEQFCNVDSIFNTLLHDLQLYLKNHYTWWLSPDESIVTLEELLRSSQAEEV
IKSLRKRFQLILIDEFQDTDRKQWNIFAKLFAHNDFSGSLFLIGDPKQSIYEWRNADLVT
YLKAKSTFPKTSQLHLINNYRSTPQLMQAINILFCKCSPFLEIPGYEPIEYHSLTPQSSE
YFDNSQHAPIHLFSYDNVLDQAAWISQTASHLQATHGISFGRMAILVSDSAQAFDLITHC
SIPVSFSKNKSIFHLTETYLLTIAWLEAILYPENYEKIQRVLLSSLFRHDLTDILEKKEH
YSSYFFSLRSYIFDHGLLATFYHFMTLHGEALLKTPQGDLTFQEMERLCAYLGTLSSQPQ
HQLLYLQYFSETGRWEENLSFSSYSEDTEILKITTIHASKGLEYDVVFCPGLDKSKKNKS
SSEWIREMYVACTRAKKQLFIPFQTSLNSRRNTALTNYVKQEGSYASILDLAQNLSKEHP
SLFSLSTTHRQDPSTEPIYNLTPPSTFVLSPYPTKQIFSFSSVKTMLDNEVLVDSDIENP
SISSALPKGRKTGIIIHKILENISPNFKIPISKILTTVSHFVKNTHLEGYEEMIAQKLFS
TISSPLSFTSASFALKDVCPDKILSEEAFLFSNKEQLWQGAIDLFFEYNGKYYIIDWKTS
FLGETTSKYSQENLFAYIKEHNLDYQGAIYIHAAKRFLQQFDITSDVEMGFVFIRGIDSE
GNGFLCLPNYKTFNPTIDQKYPVYH
NT seq 3138 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgtttgatatttttcatcctgaaacatctatccaagggaaatattttctagaa
gcttctgcgggtactggaaagacatttaccatcgaacaaattgttttacgtgctctttta
gaaggttctgtttcccatgttgaaaatattcttgttgtaacatttacgaatgccgctact
aatgagttaaaacttaggattcaagagaacctcaaacaagctgcatcacagttaaaatct
gccattacaaaccccgagcaccctttgcctccttacttatcccctccctgtgatgtaaag
cagctttacatgcaggtgcgtaatgctttagcttcgatagatcgtatggcaatttttacc
atccacgggttttgtaattacgttttgcaacagcattttccagaaatgcaaatctcgcaa
aaaaactcggctcttacgcactcacaaacggttttacatcatattcgtaagtatttatcc
caagatctttgggagaacgtcttatttcctgaacaattttacttacttgcggcacggtat
aactctaattccaaacacacatcttttttgacagataagttactttcaagttacacagtc
cagacttttgatcacctaccatctaaaagcaccaccacatccttgttaaacacttggcat
agctctattcgatctaaaatcaaagatatccctaaagaaaacttcttagaacaagctctt
aaatatacggagagtttcaaaaaacagcctttctctataactgaggaccttctatccttt
gtagatcatttgtatgcttcagaaacatcagtgcgcctgctttctttttctaagatagca
gaaactttccatcccaaaaatcgtttagcacgttatcaaccttgtcacgcttttagctat
atagaagaaacatcatggtttcaagataccgagcaattttgcaatgtagacagtattttc
aacaccttgcttcacgacttacaattgtatttaaaaaaccactacacttggtggctatct
ccagatgaaagcattgtcacactagaagagctgctgcgctcttctcaagctgaagaagtg
ataaaatccctaagaaagcgattccagctcatattaatcgatgaatttcaagatacggat
aggaaacaatggaatatttttgcaaaactatttgctcacaatgatttctctggatcccta
tttctaataggtgatcccaaacaatcgatttatgaatggagaaatgctgatctcgttacc
tatttaaaagcaaaatctacatttcctaaaacgtcacagctgcatcttatcaacaactac
cgttctacaccacagttgatgcaggccatcaatattctcttctgtaaatgttctcctttt
ctagaaattcctggttatgaacctatagaatatcattccttaaccccacagagttcagag
tattttgataactcccaacatgcgcctattcacttattttcttatgacaatgttcttgac
caagctgcgtggatatctcaaacagcttcacatttacaagctactcatggaatctctttt
ggacgcatggcaattttagtatcggattcggctcaagcattcgatttaataacccactgc
agtattcctgtatcattttctaaaaataaatcgatatttcatcttactgaaacatatcta
ttaaccatagcttggctagaggctatcctctatccagaaaactatgaaaaaatacaaagg
gttttactgagtagcctatttcgacatgacctcaccgatattctagagaaaaaagaacac
tactcctcttattttttctctctacgcagttatatttttgatcatgggcttttggctaca
ttttatcatttcatgactcttcatggagaagctttactcaaaactcctcaaggagacctg
actttccaagaaatggaaaggctttgtgcatacttaggaacgctttcttcacaacctcaa
caccaacttctctatttgcaatatttctcagagacaggacgttgggaagaaaacctgtcg
ttttcatcttattccgaagacacagaaatcctaaaaatcactacaattcacgcatctaag
ggattggaatatgatgttgttttttgcccaggactagataaatcaaaaaaaaataaaagt
tcttcagaatggataagagaaatgtacgtagcgtgtactcgagctaaaaaacaactcttt
atccctttccaaacttctttaaattcaagacgcaataccgctcttacaaactatgtaaag
caggagggatcgtatgcatctatcctcgatctcgcccaaaatttatccaaagagcatccc
tccttattttctttatcaaccacacacagacaggatccatccactgagcctatttataac
cttaccccaccttcaacttttgtgttatcgccctatcctacaaaacagattttctctttc
tcctctgtaaaaacgatgttagataacgaagtgcttgtagatagtgacattgagaaccct
tcgatctcttcagcacttcctaaaggaagaaaaacgggtattatcattcataaaatccta
gagaatatatctccaaattttaaaattcccatttctaaaatcttaactacagtctcacac
ttcgtgaaaaacactcatttagaggggtatgaagaaatgatcgcacaaaagcttttctca
actatttcttcaccgctatcttttacctccgcatcctttgccttaaaagatgtctgccct
gacaaaatacttagtgaagaagcctttctcttttctaataaagaacagttgtggcaggga
gcaattgacctatttttcgagtataatggcaagtattacattatagattggaaaacatcc
ttcttaggagaaactacctcaaaatattctcaagaaaatctctttgcttacatcaaagag
cataacctggattatcaaggtgccatttacatccatgcagcaaaacgctttttgcaacaa
tttgatattaccagtgacgtagaaatgggatttgtatttattcgaggtatcgattctgaa
ggaaacggctttttgtgcttaccaaactacaaaacatttaatcccacaatagaccaaaaa
tatccggtctatcattag

DBGET integrated database retrieval system