KEGG   Chlamydia psittaci 84/55: B595_0489Help
Entry
B595_0489         CDS       T02308                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpsb  Chlamydia psittaci 84/55
Pathway
cpsb00020  Citrate cycle (TCA cycle)
cpsb00310  Lysine degradation
cpsb01100  Metabolic pathways
cpsb01110  Biosynthesis of secondary metabolites
cpsb01120  Microbial metabolism in diverse environments
cpsb01130  Biosynthesis of antibiotics
cpsb01200  Carbon metabolism
Module
cpsb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpsb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B595_0489 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    B595_0489 (sucB)
Enzymes [BR:cpsb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B595_0489 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFS19458
Position
473132..474229
Genome map
AA seq 365 aa AA seqDB search
MITEVRIPNVAESISEVTIASLLVTSESLVQENQGIMEIESDKVNQLIYAPISGRIVWSV
AEGDVVAVGGIVATIYDANESVSESTAKETPVEETVDAEIINFPRSTAHNPPSEGKTFVP
LREKMQEEPQRSGAKNEVRERMSSIRKTISRRLVTALHESAMLTTFNEIHMTPLMQLRKE
KQEAFSSRYNVKLGLMSFFIKAVIEALKAYPRVNAYIDGDEIVYRQYYDISIAVGTERGL
VVPVIRECDKLSSGDIEVKLADLASRARDGLISLPELEGGSFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVIDNTIAIADMMYVAFSYDHRIIDGKEAVGFLIKIKDAIEQPE
GLLDF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagaagtacgcattccaaatgtcgctgaatccataagcgaagtcaccatagct
tctcttttggtgacttcagagagtctggttcaggagaatcaaggtattatggagatcgaa
agcgataaggtaaatcaacttatctatgctcctatatcgggaaggatcgtttggtctgtc
gctgaaggagacgttgttgccgtcggtggaatcgttgctacgatctatgatgctaatgaa
tctgtttccgaaagtacagcgaaggaaactccggtagaggagacagtagatgcggagatt
attaatttcccgaggtctacagctcacaatcctccttctgagggaaaaacatttgttcct
ttacgtgagaaaatgcaagaagaaccgcaacgttcgggagctaaaaatgaggttcgtgag
cgtatgtcatccatacgcaaaacgatttctcgacgtttagttacagctcttcatgaatca
gcaatgttaacaacattcaatgagattcatatgacccctctgatgcaacttcggaaggaa
aaacaagaggccttttcttctcgctataatgtgaaactcggtttgatgtcctttttcata
aaagcagttattgaagctctgaaggcttatccccgtgtaaatgcgtatattgatggcgat
gaaattgtctatcgtcagtattacgatatttccattgctgtaggaacagaacgcggtctt
gttgtccctgtgattcgtgagtgcgataaactctctagtggcgatatcgaagtgaaactt
gcagatttggcaagtagagctcgagatggtttaatttctcttccagagttagaaggagga
agtttcactattaccaatggtggggtgtatggttccttactttctacgccgattatcaat
cctcctcaagtggggatattgggaatgcacaaaatagaaaaacgccctgtagtgatcgat
aatacaatcgccattgcggatatgatgtatgttgcctttagctacgaccatcgtatcatc
gatggtaaagaggcggttggtttccttatcaaaatcaaagatgctatagaacaaccagaa
gggttacttgatttttaa

DBGET integrated database retrieval system