KEGG   Chlamydia psittaci CP3: B711_0755Help
Entry
B711_0755         CDS       T02251                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00230  Purine metabolism
cpsc01100  Metabolic pathways
Module
cpsc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B711_0755 (gmk)
Enzymes [BR:cpsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     B711_0755 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Thymidylate_kin AAA_16 Cytidylate_kin AAA_22 dNK AAA_17 AAA_33 AAA AAA_23 Cytidylate_kin2 ABC_tran AAA_30 TsaE Zeta_toxin cobW RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFS27148
Position
complement(741447..742061)
Genome map
AA seq 204 aa AA seqDB search
MKDKVRVPFSPDHPLCVPKLFTISAPAGAGKTTLVRMLAQEFPDSFQKTLSLTTRAPRPE
EVPGVDYQFVSQEEFQRRLDNDDFLEWVALFGEYYGTSRLGIDEIWKSGRHAVAVIDVEG
ALVLRSKIPTVTIFISAPSQEELERRLKQRGSEQDTQRQERLQHSLIEQAAANKFEYVII
NDDLEKSYEVLKSIFIAEEHRNVL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaagttcgtgttcctttttctcccgatcatcccctatgcgtaccaaaatta
tttactattagtgctcctgctggagctgggaaaacaacgctagtacgtatgttggctcaa
gaatttccagattcttttcagaagactttatcacttacaacacgagcacctcgtcctgaa
gaagttcctggagtagattatcagtttgtttctcaagaggagtttcaacgacgcttagac
aatgatgattttcttgagtgggtagcactttttggagagtattacggaacgagtcgttta
gggattgatgaaatttggaaatctgggagacacgcggttgcggttattgacgtggaagga
gctttggtcttgcggagtaaaattcccacagtgacgatttttatttctgcgccatctcag
gaagagctagaaaggcgtctaaaacaaagaggatcagaacaagatactcaaagacaagag
cggttgcagcatagtcttattgaacaagctgcggctaataaatttgaatacgtcattatc
aatgatgatttggagaaatcttacgaggttttgaaaagtatttttatagcagaagaacat
aggaacgtattatga

DBGET integrated database retrieval system