KEGG   Chlamydia psittaci CP3: B711_0788Help
Entry
B711_0788         CDS       T02251                                 

Definition
(GenBank) V-type ATPase, D subunit
  KO
K02120  V/A-type H+/Na+-transporting ATPase subunit D
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00190  Oxidative phosphorylation
cpsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    B711_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_D
Motif
Other DBs
NCBI-ProteinID: AFS27181
Position
complement(783381..784007)
Genome map
AA seq 208 aa AA seqDB search
MSSQVKLTKNAYRLEKVKLSRLETYLPTLKLKKALLQVEVTNAIREASESIRAYEGSRES
IYAFAELYSVPLYVDAIVNSFKIEKVAKEYENIAGVEVPVIKNIVLTESSYSVLDTPIWV
DTLVAYTREFVVNKVRSEVAVEKQRILEDELRNVSIRVNLFEKKLIPETTRMIKKIAIFL
SDRSITDVGQVKMAKKKIQQRKEESECA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacaggtaaagttaacaaagaacgcctatcgtttagaaaaggtaaaactttct
cgtctggaaacatatttaccaacgttaaaattaaagaaagccttgttacaagtagaagta
accaatgctattcgagaggccagtgaaagtatacgcgcatatgaaggatctagagaaagc
atatatgcctttgctgagctctatagtgttcctctctatgttgacgctatagtaaatagc
tttaagatcgaaaaagtagcaaaagaatatgaaaacatcgcaggcgtcgaagttcctgta
ataaagaatatcgttctaacggaatcttcttattctgttttagataccccgatctgggta
gacactcttgtcgcttacaccagagagtttgtagttaataaagtacgctctgaagtggct
gtagaaaagcaaagaattttagaagacgagttaagaaatgtctctattcgtgtaaatctt
tttgagaaaaagctgattccagagacaacacgtatgattaagaaaatagcaattttcttg
agtgatcgtagtattacagatgttggccaagtaaagatggctaagaaaaagatacagcag
cgtaaggaggaatccgaatgcgcgtaa

DBGET integrated database retrieval system