KEGG   Chlamydia psittaci CP3: B711_0796Help
Entry
B711_0796         CDS       T02251                                 

Gene name
rpoC
Definition
(GenBank) DNA-directed RNA polymerase, beta' subunit
  KO
K03046  DNA-directed RNA polymerase subunit beta' [EC:2.7.7.6]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00230  Purine metabolism
cpsc00240  Pyrimidine metabolism
cpsc01100  Metabolic pathways
cpsc03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B711_0796 (rpoC)
   00240 Pyrimidine metabolism
    B711_0796 (rpoC)
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    B711_0796 (rpoC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cpsc03021]
    B711_0796 (rpoC)
   03400 DNA repair and recombination proteins [BR:cpsc03400]
    B711_0796 (rpoC)
Enzymes [BR:cpsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     B711_0796 (rpoC)
Transcription machinery [BR:cpsc03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     B711_0796 (rpoC)
DNA repair and recombination proteins [BR:cpsc03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      B711_0796 (rpoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb1_1 RNA_pol_Rpb1_5 RNA_pol_Rpb1_2 RNA_pol_Rpb1_3 RNA_pol_Rpb1_4 Biotin_lipoyl Mei5
Motif
Other DBs
NCBI-ProteinID: AFS27189
Position
complement(790971..795152)
Genome map
AA seq 1393 aa AA seqDB search
MFGEGSRDNVSLSKEGLFDKLEIGIASDITIRDKWSCGEIKKPETINYRTFKPEKGGLFC
EKIFGPTKDWECCCGKYKKIKHKGIVCDRCGVEVTLSKVRRERMAHIELAVPIVHIWFFK
TTPSRIGNVLGMTASDLERIIYYEEYVVIDPGKTDLNKKQLLNDAQYREVIEKWGKDSFV
AKMGGEAIYDLLKSEDLQSLLKELKDRLRKTKSQQARMKLAKRLKIIEGFVSSSNHAEWM
VLKSVPVVPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKAILRLKTPEVIVRNEKR
MLQEAVDALFDNGRHGHPVMGAGNRPLKSLSEMLKGKNGRFRQNLLGKRVDYSGRSVIIV
GPELKFNQCGLPKEMALELFEPFIIKRLKDQGSVYTIRSAKKMIQRGAPEVWDVLEEIIK
GHPVLLNRAPTLHRLGIQAFEPVLIEGKAIRVHPLVCAAFNADFDGDQMAVHVPLSIEAQ
LEAKVLMMAPDNIFLPSSGKPVATPSKDMTLGIYYLMADPTYFPEEHGGKVKIFRDVTEV
LRALYSGGFLDEHTNGRRDETGRGIHIHEKIKVRIDGQVIETTPGRVLFNRIVPKELGFQ
NYSMPSKRISELILQCYKKVGLEATVRFLDDLKDLGFIQATKAAISMGLKDVKIPEIKSE
ILKEAYDKVAIVKKQYDDGIITDGERHSKTISIWTEVSELLSDALYVEISKQTKSKHNPL
FLMIDSGARGNKSQLKQLGALRGLMAKPNGAIIESPITSNFREGLTVLEYSISSHGARKG
LADTALKTADSGYLTRRLVDVAQDVIITEKDCGTLNHIEITAIRQGSEELLPLKDRIYGR
TVSEDIYQPGDKSKLLAKNGDVITSAQAELIDDAGIESIKIRSTLTCESRRGVCAKCYGL
NLANGRLIGLGEAVGIIAAQSIGEPGTQLTMRTFHLGGIAATSSTPEIVTDCDGILVYMD
LRVVVGQDGNHLVLNKKGAIHVVRDEGRSLEEYKKLLSTKSIESLETYPVELGVKILVGD
GEKVTAGQRIAEVELHNIPIICDKPGFVKYEDLVEGISTEKVVNKNTGLVELIVKQHRGE
LHPQIAIYSDPGLTELVGTYAIPSGAIVSVEENQKVDPGMLLARLPRGAIKTKDITGGLP
RVAELVEARKPEDAADIAKIDGVVDFKGIQKSKRILVVRDEITGMEEEHLIPLTKHLIVQ
RGDHVMKGQQLTDGLVVPHEILEICGVRELQKYLVNEVQEVYRLQGVDINDKHIEIIVRQ
MLQKVRITDPGDTTLLFGEEVNKKEFYEENKRTEEEGGKPAQAVPVLLGITKASLGTESF
ISAASFQDTTRVLTDAACSSKTDYLLGFKENVIMGHMIPGGTGFDTHKRIKQYLEKEQEE
LVFDFVSESECAC
NT seq 4182 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagaaggttctcgagacaatgtctctctatctaaagaggggctatttgataaa
ttagaaattggaattgcctcagatattactattcgcgataagtggtcttgtggggaaatc
aagaagcctgaaacaatcaattaccgtacgtttaaacctgaaaaaggtggactattttgc
gaaaagatttttggtcccacaaaggattgggaatgctgttgtggtaaatacaagaagatt
aagcataaaggtattgtttgtgatcgctgcggagtagaggttactctttctaaggttcgt
cgtgaacgtatggctcatattgagctggctgtgcctatcgtacatatatggttttttaag
actacaccatcaagaataggtaacgtcttaggaatgaccgcttctgatcttgaaagaatt
atttattacgaagaatatgtagttatcgatccaggtaagacagatttaaataaaaagcag
cttttaaatgatgctcagtatcgagaagtcattgagaagtggggaaaagattctttcgta
gccaaaatgggcggagaggctatctatgatttattgaaatcagaagatcttcaaagtcta
ttaaaagagcttaaggatcgtttgcgaaaaaccaaatctcagcaagccagaatgaaactt
gctaagcgattaaaaattatcgaaggttttgtctcttcttcgaatcacgctgagtggatg
gttttaaaaagtgttcccgtcgttccacccgatctacgtcctttagttccattagatggt
ggaaggtttgcaacttctgatttaaatgatctataccgtcgtgtaattaaccgaaataat
cgtttaaaagctattttaaggctaaaaactcctgaagtgatcgtacgtaatgaaaaacgt
atgttacaggaagccgtggacgctctatttgataacggtcgtcatggacaccctgtcatg
ggagcagggaatcgtccattaaaatccctttctgaaatgctaaaagggaaaaatggacgc
ttccgacaaaatcttttaggtaagcgtgttgattattctggacgttctgtcattatcgta
ggtcctgaattgaagtttaatcaatgcggtttgcctaaagaaatggctcttgagttgttt
gaaccgttcattattaaaagattaaaagatcagggtagtgtctatactattcgttctgct
aagaaaatgattcaacgtggagctcctgaagtttgggatgttctagaagaaattattaaa
ggccatccagtattgcttaaccgagcccccacactccaccgtttagggatacaggcgttt
gaacctgtattaatcgaaggtaaagcgattcgtgtgcatcccctagtctgtgcagcattt
aacgcggacttcgatggagaccaaatggctgttcacgtgccgctgtctatagaagcacag
ttagaagccaaagttttgatgatggctcctgataacatcttcttgccgtcttctggaaag
cctgtcgctacaccttctaaggatatgaccttaggtatttactatctgatggcagacccg
acatatttcccggaagagcatggaggaaaagtcaaaatctttagggatgttacggaagtc
ttgcgagcattgtattctggcggattcctagatgagcatacaaatggtcgtcgcgatgaa
acaggccgtggtattcatattcacgagaaaattaaagtacgcatcgatggtcaggttatt
gaaactactccaggaagagttctgtttaatagaattgttcctaaagagttagggttccaa
aactatagcatgccaagtaagcgtatcagtgaattgattttacaatgctataaaaaagta
gggcttgaggctactgtacgcttcttagatgatcttaaagatttaggatttatccaagcg
acgaaagctgcgatctctatgggattgaaagatgtaaaaattcctgagattaaaagtgaa
attcttaaagaagcttatgacaaggttgccattgttaagaaacaatatgatgatggtatt
atcaccgatggtgaacgtcattctaaaactattagtatttggacagaggtttcagaactc
ttgtcagacgctctttatgttgaaattagtaagcaaactaaaagtaaacacaaccctctg
ttcttgatgatagattcaggagctcgaggtaataagtctcagttgaagcagttaggagct
ctacgaggtttaatggctaagccaaacggtgcgattatcgaatctccgattacctcgaac
ttccgcgaaggattaaccgttcttgagtattccatttcttctcacggtgctagaaaaggt
ttagctgatactgcattgaagacagctgactctggatatttaactcgaagacttgttgac
gtagctcaagatgttatcattacggaaaaagattgcggaacattgaatcatatcgaaatt
actgcaattcgacagggttcagaagagcttctacctttaaaagatcgtatttatggtcgt
acggtatcagaagatatctatcaacccggtgataaaagtaagcttctagctaagaatgga
gatgtgattacatctgctcaggctgaacttattgatgatgctggaattgaaagtattaaa
atccgctctacacttacttgtgaaagtcgtcgtggtgtttgtgctaagtgttatggatta
aaccttgctaatggtcgcctgattggtttaggagaagctgtgggtattatagctgctcaa
tccattggtgaacctggaacacagctaacgatgagaacgttccaccttggaggtatcgca
gctacatcttcaactccagaaattgttacagattgtgacggtatcctagtatacatggat
ctacgtgtggttgtgggtcaagatggaaatcacttagtcttgaataagaaaggtgctatc
catgttgtccgtgatgaaggacgtagtttagaagagtacaagaaacttctaagcaccaag
tctatagaaagtttagaaacttatccggtagaactcggtgttaagattttagtaggtgat
ggggagaaggtaactgcaggccaaagaattgctgaggtcgaattacataatattccaatt
atctgtgataagcctggttttgtaaaatacgaagacttagtagagggtatttctacagag
aaagtagttaataagaacacaggtttagtcgagcttattgttaaacagcatcgtggagaa
ctgcatcctcaaattgctatttattctgatcccggtttgacggaattggttggaacatac
gctattccttctggagcgattgtttctgtcgaagaaaatcaaaaagtcgaccctggtatg
ttattagcaagattacctcgaggggcaattaagactaaggatattactggaggtctacct
agggttgctgaattagttgaagctcgtaagcctgaagacgctgcagatattgcaaagatt
gatggtgttgtagactttaaaggaattcagaaaagtaaacgtattcttgttgttcgtgac
gaaataacaggaatggaagaagaacatctgattcctttgaccaagcacttgattgttcaa
cgtggagatcatgtgatgaagggacagcagctaacagatggtttggttgttccacatgaa
atcctagaaatttgtggcgttcgcgaattgcaaaagtacttagtcaatgaggttcaagaa
gtttatcgtctgcagggtgtagacatcaatgataagcatatagaaatcattgttcgtcaa
atgttgcagaaggttcgcattactgatccaggtgatactactttactcttcggagaagaa
gtaaacaaaaaagaattctacgaagagaataaacgtacagaagaggaaggtgggaaacca
gcacaagctgttccagtattattgggaattaccaaagcttcgttgggtacagaatccttt
atttctgccgcatccttccaagatacgactcgggtattaactgatgctgcgtgtagtagt
aaaactgactacctgttaggattcaaagagaatgtcattatggggcatatgattcctgga
ggtacagggtttgatacacacaagcgtattaagcagtacttagaaaaggaacaagaggaa
cttgtctttgactttgtaagcgaatctgaatgcgcttgttag

DBGET integrated database retrieval system