KEGG   Chlamydia psittaci CP3: B711_0799Help
Entry
B711_0799         CDS       T02251                                 

Definition
(GenBank) ribosomal L10 family protein
  KO
K02864  large subunit ribosomal protein L10
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc03010  Ribosome
Module
cpsc_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B711_0799
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cpsc03011]
    B711_0799
Ribosome [BR:cpsc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    B711_0799
  Bacteria
    B711_0799
  Archaea
    B711_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L10
Motif
Other DBs
NCBI-ProteinID: AFS27192
Position
complement(799515..800027)
Genome map
AA seq 170 aa AA seqDB search
MKEEKKLLLQEVEEKISASQGFILLRYLGFTAAHSREFRNSLSGVSAEFEVLKKRIFFKA
IQSAGFDMDSSDTSGHLGVVFAYDDAVSAAKQVLDFNKQHNDSLVFLAGRIDSANLSGKE
VEAVAKLPSMKELRQQIVGLLAAPMSQVVGIMGSALSGVISCIDQKTQKN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagaaaagaaattactccttcaagaggtagaagagaagatctccgcatcccaa
ggttttattttattgagatatcttggatttacggcagcacactctagagagtttcgtaat
tcactctccggagtttctgcagaatttgaagtattaaaaaagagaatttttttcaaagct
atacaaagcgccggttttgatatggattcttcggatacaagcggacacctaggtgtagtc
tttgcttatgatgatgctgtttctgcagcaaaacaagtattagattttaataaacaacat
aacgattcactagtttttcttgccggacgaattgatagcgctaacttgtcaggtaaagaa
gtagaggctgttgccaaattgccttcaatgaaagaactgagacagcaaattgttggacta
ttagctgctccgatgtctcaggtcgttggaattatgggctcagctctttctggtgttatt
tcctgcatcgaccagaaaacgcaaaaaaactaa

DBGET integrated database retrieval system