KEGG   Chlamydia psittaci CP3: B711_0803Help
Entry
B711_0803         CDS       T02251                                 

Gene name
secE
Definition
(GenBank) preprotein translocase, SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc02024  Quorum sensing
cpsc03060  Protein export
cpsc03070  Bacterial secretion system
Module
cpsc_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    B711_0803 (secE)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    B711_0803 (secE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B711_0803 (secE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cpsc02044]
    B711_0803 (secE)
Secretion system [BR:cpsc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   B711_0803 (secE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE HK97-gp10_like DUF4407
Motif
Other DBs
NCBI-ProteinID: AFS27196
Position
complement(801846..802091)
Genome map
AA seq 81 aa AA seqDB search
MKQRNHQETLSKKIAKAKKQAGAGFLDEIKKIAWVSKRDLKRYVKIVIASIFGLGFSIYC
VDLVFRKLLTLLSGITSFLFG
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgcaatcaccaagagacactctctaagaaaatcgctaaagctaaaaagcaa
gctggtgctggctttctagatgaaattaaaaaaattgcatgggtcagtaaacgagattta
aaacgatacgttaagatcgtaatagctagtatttttggcttaggcttttctatatattgt
gtagatttggtgtttcgtaagctacttacattgttaagtggtataacaagctttttgttt
ggttag

DBGET integrated database retrieval system