KEGG   Chlamydia psittaci CP3: B711_0808Help
Entry
B711_0808         CDS       T02251                                 

Definition
(GenBank) putative transmembrane protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EXS
Motif
Other DBs
NCBI-ProteinID: AFS27199
Position
804148..805134
Genome map
AA seq 328 aa AA seqDB search
MISSVTFSTPHPNGLESMAAMQDHSGSDSESVNTNIENPQPPNSVLRGITTSSRPPLSLM
NILPYRPAPRTCMDHARSVGEKISTFLRDNWKYILLYILAWALILACHHTMAVTLTIWLG
IGLGVGVLFGIFTANVLDRKNKYKNTNSLWNLMNYGLQQLDPNGTRQILLATIIASISSL
IYAIPEAVGFTIGACIGNQISILISYGLRLGDDDNYVADRQAFDKKVAHIQKAINQYQLI
KNQMIIQKQISEIVAQQNNPQMTNTLHTLQLQMNTPLPYVFDAPKTQFSDHLHFSDPDYV
IASANQRILALSQTLTHLRQEPNRVVEE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatatcttctgttacttttagcactcctcatcctaatggtttggagagcatggcagcc
atgcaagatcacagtggatccgatagtgaatctgtgaatacgaatatagagaacccacag
ccacctaatagcgtacttaggggaataactacatcttctcgccctcccctctctctgatg
aatattctcccttaccgaccagctccaagaacatgtatggaccatgctcgatctgtaggg
gaaaaaattagtacgtttttaagggataactggaaatatattttattgtatatccttgct
tgggcattaatattggcctgtcatcatactatggcagtaacactgaccatttggctgggt
ataggcttaggtgttggtgttctttttggtatttttaccgccaatgttttggataggaaa
aataagtataaaaatacaaacagcctgtggaatttgatgaattatgggttacagcagctt
gatcccaatggaacgcgccaaattcttttagcaacaatcattgcttctatttcttcgcta
atttacgctattcctgaagctgttggatttacgattggtgcatgcataggcaaccaaatc
agtattctcatttcctacggtctccgcttaggcgatgacgacaattatgtcgctgatcgg
caagcttttgataaaaaggtggcgcacattcagaaagcgattaatcagtaccaattaatt
aaaaatcaaatgatcattcagaagcaaatttctgaaattgtcgcccaacaaaataatcct
caaatgaccaatacgttgcataccctgcaactacaaatgaatacgccattaccatacgta
tttgatgcacctaaaacacaatttagtgatcacctacattttagtgatcctgattatgtt
atcgcttctgcgaatcaaagaattttagctctatcacaaactctaacccatctaagacaa
gagcctaatcgtgttgttgaggagtag

DBGET integrated database retrieval system