KEGG   Chlamydia psittaci CP3: B711_0814Help
Entry
B711_0814         CDS       T02251                                 

Definition
(GenBank) putative transmembrane protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Claudin_2 IncE DUF373 YopX DUF3040 SPC12
Motif
Other DBs
NCBI-ProteinID: AFS27204
Position
complement(808971..809315)
Genome map
AA seq 114 aa AA seqDB search
MATVIPTGFCLQNQEPINLWDEFPLAERVCVILSIVLVIFGVICSIIGMLLGSITTGVIG
FSLYIISIFLLLRGVVIYNHFSLNYLVYGSLDKNYRSSEVWGNIYDSPHRLVYD
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtaattcctacaggtttctgtttgcaaaatcaggaaccgatcaatctatgg
gacgagtttcctttggctgagagagtatgcgtgatactttctattgtgcttgttattttc
ggtgtcatttgtagtataatcggtatgctacttggttccataaccacaggcgtcataggt
tttagtctctacatcattagtatctttttacttttgcgtggagttgtgatttacaatcat
ttttctttgaactacttagtctatggctcattagataaaaattatcgttcaagtgaagtt
tgggggaatatctacgacagtccccatcgactcgtctatgattaa

DBGET integrated database retrieval system