KEGG   Chlamydia psittaci CP3: B711_0833Help
Entry
B711_0833         CDS       T02251                                 

Definition
(GenBank) shikimate kinase family protein
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpsc01100  Metabolic pathways
cpsc01110  Biosynthesis of secondary metabolites
cpsc01130  Biosynthesis of antibiotics
cpsc01230  Biosynthesis of amino acids
Module
cpsc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B711_0833
Enzymes [BR:cpsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     B711_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI
Motif
Other DBs
NCBI-ProteinID: AFS27223
Position
826852..827265
Genome map
AA seq 137 aa AA seqDB search
MNYGNKLHSSACEIFQAVGEQEFTKLEIEALRSISLDNSVTALGGGTIMHQEACDIIKNR
GLLVYLSLPIAQICERLLKRGLPERLKRAPNMEEILQQRIERMQRICDYHFPLDEVDLLD
ERSLLSACESLNTLLNQ
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaactacggcaacaagctacattcctcggcctgcgaaatattccaagctgttggagaa
caagagtttacaaaattagaaattgaagctctccgttctatctctctagataatagtgtc
actgctttaggcggaggaaccatcatgcatcaagaagcatgtgatataattaaaaataga
ggactgctggtttacctatcccttcctatagctcagatttgtgaaaggctcttaaaacgt
ggtcttcctgaaagattaaaacgagctccaaatatggaagaaatcttacaacaacgtata
gagcgtatgcaacgcatctgtgattatcacttccctcttgacgaggtagatcttttagat
gaacgttcattattatctgcgtgtgaatctttgaataccttactaaatcaatga

DBGET integrated database retrieval system