KEGG   Chlamydia psittaci CP3: B711_0840Help
Entry
B711_0840         CDS       T02251                                 

Gene name
aaxC
Definition
(GenBank) arginine/agmatine antiporter
  KO
K03758  arginine:ornithine antiporter / lysine permease
Organism
cpsc  Chlamydia psittaci CP3
Brite
Transporters [BR:cpsc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   B711_0840 (aaxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease
Motif
Other DBs
NCBI-ProteinID: AFS27230
Position
833819..835279
Genome map
AA seq 486 aa AA seqDB search
MISNGSKSGKNLGAIALAGMVISSMIGGGIFSLPQNMAASAGVGAIILAWILTGVGMFFI
ANTFKILSLVRPDLTTGIYMYSREGFGPYIGFTIGWGYWLCQIFGNVGYAVMTMDALNYF
FPPYFQGGNTIPAIIGGSILIWVFNFIVLKGIRQASFINVIGTVCKLVPLIVFIIITAFL
FKLAIFKTDFWGDTVTKTQPLLGSVTSQLKSTMLVTLWAFIGIEGAVVMSARAKSPSAVG
KATILGFTGCLTVYVLLSILPFGSLFQHQLAGIANPSTAGVLGILVGKWGEVLMNVGLLV
AILSSWLSWTMIVAEIPYSAAKNGTFPEIFTIKNADRSPKVSLYITSALMQVAMLLVYFS
TNAWNTMLSITGVMVLPAYFASAAFLVKFSKDKKYPNKGPIKAFTAKITGLLGAAYSIWL
IYAGGLKYLLMAIILLALGIPFYIDAGKKGRNAKTFFAKKEITEITIIAFLALLAIFLFS
TEKIRL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaatgggagtaaatccgggaaaaatctcggagccatagctttggcaggtatg
gtaattagctccatgattgggggaggaattttcagccttccccaaaatatggcagcatct
gcaggagtaggagcaattatcttagcatggatcctaacaggcgtaggcatgtttttcatt
gccaatacttttaaaattctctcattagtgcgccctgacttaacgacagggatctatatg
tacagccgagaaggattcggcccctacataggatttaccattgggtggggatattggtta
tgccagatctttggtaatgtcggttatgctgtaatgaccatggatgcgttaaactatttc
ttcccaccctactttcaaggaggaaatacgatacccgcaattataggaggctccatactc
atatgggttttcaatttcatcgtcttgaagggcatccgtcaggcatcgttcattaacgtc
atcggaaccgtatgcaaactcgttcctcttattgtattcattatcattacagcctttctt
ttcaaacttgcgattttcaaaacagatttttggggggatacggttacaaaaacacaaccg
ttattaggatctgtaactagtcagctaaaaagcaccatgttagttaccttgtgggctttc
ataggaatcgaaggagctgtagttatgtccgcacgtgcaaaaagtcccagtgctgttgga
aaagctacgattttaggttttactggttgtcttaccgtttacgtacttttatctatctta
ccgtttggctccttatttcaacatcaactcgcaggtattgccaacccttcaaccgcggga
gtattaggtattctcgtaggaaaatggggagaagttttaatgaacgtcggtctccttgtt
gccatactctctagttggttatcctggacgatgatcgttgctgagatcccttattctgcg
gcaaaaaatggtacattcccagagattttcactatcaaaaatgctgatcgctctccgaaa
gtttcgttatacatcactagcgctctcatgcaagtcgctatgcttctggtgtacttttca
accaacgcatggaatacgatgttgagcattacaggcgtcatggttttacctgcctatttt
gcaagcgctgcttttcttgtgaagtttagtaaagacaaaaaatacccaaataagggacca
atcaaagcctttactgcaaaaattacaggactccttggtgctgcttattctatttggctc
atctatgctggaggactgaaatatctacttatggcaattattctcctggctttaggtatt
cctttttacattgatgctgggaaaaaaggcaggaatgcaaaaactttttttgcaaaaaaa
gagattacagaaattacaataattgcttttttagcattactcgctatattcctcttttca
acggagaaaatccgtttataa

DBGET integrated database retrieval system